DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir85a and Ir56b

DIOPT Version :9

Sequence 1:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_611430.1 Gene:Ir56b / 37250 FlyBaseID:FBgn0034456 Length:408 Species:Drosophila melanogaster


Alignment Length:319 Identity:69/319 - (21%)
Similarity:116/319 - (36%) Gaps:63/319 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 CVIVPKAKTAPTFWNIFRSFGSLVW-ALILVSVLVANVFCYILKSEVGRV----------PMQLF 354
            ||:||.|...|.:..:....|..:| .|.|.:..||.:..|:...|.|..          .|.|.
  Fly   111 CVMVPLAPELPKWMYMVWPLGKYIWTCLFLGTFYVALLLRYVHWREPGNATRSYTRNVLHAMALL 175

  Fly   355 AGALTMPMTQIPPNHSIRLFLIFWL--YFGLLICSAFKGNLTSMMVFQPYLPDINQLGALARSHY 417
            ..:..|.|:....:.|||:.:.:.|  .||.::.:....::|:..:...:|..|:....|..|..
  Fly   176 MFSANMNMSVKLKHASIRVIIFYTLLYIFGFILTNYHLSHMTAFDMKPVFLRPIDTWSDLIHSRL 240

  Fly   418 HIIIRPRHVKHIQHFLTLGHKHESRIRE-------QMLEVSDTQMYEMMRNNDIRFAYLEKYHIA 475
            .|:|                 |:|.:.|       |.|..|.::.|..:...|....:       
  Fly   241 RIVI-----------------HDSLLEELRWLPVYQALLASPSRSYAYVVTQDAWLFF------- 281

  Fly   476 RFQVNSRVHMHLGRPLFHLMNSCLVP-FHAVYIVPYGSPYLGFLDSL---IRSSHEFGFERYWDR 536
                 :|....|.:|.|||...|... |:|:.:....|    |.|||   |.:..:.|...||:.
  Fly   282 -----NRQQKVLIQPYFHLSKVCFGGLFNALPMASNAS----FADSLNKFILNVWQAGLWNYWEE 337

  Fly   537 IMNSAFIKSGVKVVNRRRGSGNDEPV-VLKLQHFHAVFALWLVGIGMACIVLAWEHLTH 594
            :......::|...|..     :..|| .|.|:.|...:.:...||.::.:....|...|
  Fly   338 LAFRYAEQAGYAKVFL-----DTYPVEPLNLEFFTTAWIVLSAGIPISSLAFCLELFIH 391



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.