DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir85a and spp-22

DIOPT Version :9

Sequence 1:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster
Sequence 2:NP_001025004.2 Gene:spp-22 / 3565459 WormBaseID:WBGene00044283 Length:149 Species:Caenorhabditis elegans


Alignment Length:143 Identity:25/143 - (17%)
Similarity:52/143 - (36%) Gaps:39/143 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 LGTDGLLAA--YVAERLNATMMITRPHSYNNHNLSSDIC----------FLEVAKEYVDVAMNIR 278
            |..|.:|..  |..|::|...           .:|.|:|          |:::.|:::::     
 Worm    30 LEKDRMLTTNEYYVEKVNQMA-----------GISCDLCMRAVYGVNYDFIQLKKDFIEM----- 78

  Fly   279 FLVPDTFRKQAESTVSHTRDDL--CVIVPKAKTAPTFWNIFRSFGSLVWALILVSVLVANVFCYI 341
                  .|...|:......:|:  |:.....|.......:.:...|. ...:|:.|..|:...|:
 Worm    79 ------IRLDCEALFHERPEDISECIRFLTTKVEKYSGKVEKILDSR-HVCVLLRVCAASDEDYV 136

  Fly   342 LKSEV--GRVPMQ 352
            ||:::  .:..||
 Worm   137 LKNKLSSNKTDMQ 149



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.