Sequence 1: | NP_649833.1 | Gene: | Ir85a / 41052 | FlyBaseID: | FBgn0037630 | Length: | 605 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001025004.2 | Gene: | spp-22 / 3565459 | WormBaseID: | WBGene00044283 | Length: | 149 | Species: | Caenorhabditis elegans |
Alignment Length: | 143 | Identity: | 25/143 - (17%) |
---|---|---|---|
Similarity: | 52/143 - (36%) | Gaps: | 39/143 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 226 LGTDGLLAA--YVAERLNATMMITRPHSYNNHNLSSDIC----------FLEVAKEYVDVAMNIR 278
Fly 279 FLVPDTFRKQAESTVSHTRDDL--CVIVPKAKTAPTFWNIFRSFGSLVWALILVSVLVANVFCYI 341
Fly 342 LKSEV--GRVPMQ 352 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1052 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |