| Sequence 1: | NP_649833.1 | Gene: | Ir85a / 41052 | FlyBaseID: | FBgn0037630 | Length: | 605 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001269399.1 | Gene: | GRIK4 / 2900 | HGNCID: | 4582 | Length: | 956 | Species: | Homo sapiens |
| Alignment Length: | 233 | Identity: | 41/233 - (17%) |
|---|---|---|---|
| Similarity: | 77/233 - (33%) | Gaps: | 66/233 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 196 KTIPNMQRKPLRMCIYKDDVRAIFWRQGTILGTDGLLAAYVAERLNATMMITRPHSYNNHNLSSD 260
Fly 261 ICFLEVAKEYVDVAMNIRFLVPDTFRKQAESTVSHTRDDLCVIVPKAKTAPTFWNIFRSFGSLVW 325
Fly 326 ALILVSVLVANVFCYILKSEVGRV-PMQLFA---------------------------GALTMPM 362
Fly 363 TQIPPNHSIRLFLIFWLYFGLLICSAFKGNLTSMMVFQ 400 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Ir85a | NP_649833.1 | None | |||
| GRIK4 | NP_001269399.1 | PBP1_iGluR_Kainate_KA1_2 | 26..400 | CDD:107389 | |
| ANF_receptor | 43..382 | CDD:279440 | |||
| PBP2_iGluR_kainate_KA1 | 415..785 | CDD:270442 | 41/233 (18%) | ||
| Lig_chan | 547..816 | CDD:278489 | 20/105 (19%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 863..889 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 931..956 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165155773 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1052 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.740 | |||||