Sequence 1: | NP_649833.1 | Gene: | Ir85a / 41052 | FlyBaseID: | FBgn0037630 | Length: | 605 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005165152.1 | Gene: | gria3a / 170452 | ZFINID: | ZDB-GENE-020125-5 | Length: | 903 | Species: | Danio rerio |
Alignment Length: | 250 | Identity: | 42/250 - (16%) |
---|---|---|---|
Similarity: | 87/250 - (34%) | Gaps: | 60/250 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 224 TILGTDGLLAAYVAERLNATMMITRPHSYNNH--NLSSDICFLEVAKEYVDVAMNIRFLVPDTFR 286
Fly 287 KQ-----------------AESTVSHTRDD------------LCVIVPK-AKTAPTFWNIFRSFG 321
Fly 322 SLVWALILVSVLVANVFCYILK-----------SEVGRVP---------------MQLFAGALTM 360
Fly 361 PMTQIPPNH-SIRLFLIFWLYFGLLICSAFKGNLTSMMVFQPYLPDINQLGALAR 414 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir85a | NP_649833.1 | None | |||
gria3a | XP_005165152.1 | PBP1_iGluR_AMPA_GluR3 | 28..399 | CDD:107382 | |
ANF_receptor | 39..382 | CDD:279440 | |||
PBP2_iGluR_AMPA | 415..797 | CDD:270433 | 42/249 (17%) | ||
Lig_chan | 547..810 | CDD:278489 | 21/118 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170591768 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1052 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |