DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir85a and gria3a

DIOPT Version :9

Sequence 1:NP_649833.1 Gene:Ir85a / 41052 FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster
Sequence 2:XP_005165152.1 Gene:gria3a / 170452 ZFINID:ZDB-GENE-020125-5 Length:903 Species:Danio rerio


Alignment Length:250 Identity:42/250 - (16%)
Similarity:87/250 - (34%) Gaps:60/250 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 TILGTDGLLAAYVAERLNATMMITRPHSYNNH--NLSSDICFLEVAKEYVDVAMNIRFLVPDTFR 286
            ||:.|..:.|.||..:.| .|.:.....|..:  :|:|:|......|..:.:..:.::...|...
Zfish   417 TIVVTTIMEAPYVMYKRN-YMQLEGNDRYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPET 480

  Fly   287 KQ-----------------AESTVSHTRDD------------LCVIVPK-AKTAPTFWNIFRSFG 321
            |.                 |..|::..|::            :.:::.| .|:.|..::......
Zfish   481 KTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLA 545

  Fly   322 SLVWALILVSVLVANVFCYILK-----------SEVGRVP---------------MQLFAGALTM 360
            ..:|..|:.:.:..:|..:::.           :|..:.|               :....||...
Zfish   546 YEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLDDNEETKDPQTPPDPPNDFGIFNSLWFSLGAFMQ 610

  Fly   361 PMTQIPPNH-SIRLFLIFWLYFGLLICSAFKGNLTSMMVFQPYLPDINQLGALAR 414
            ....|.|.. |.|:....|.:|.|:|.|::..||.:.:..:..:..|.....||:
Zfish   611 QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAK 665

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir85aNP_649833.1 None
gria3aXP_005165152.1 PBP1_iGluR_AMPA_GluR3 28..399 CDD:107382
ANF_receptor 39..382 CDD:279440
PBP2_iGluR_AMPA 415..797 CDD:270433 42/249 (17%)
Lig_chan 547..810 CDD:278489 21/118 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591768
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.