DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13318 and CG43124

DIOPT Version :10

Sequence 1:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster
Sequence 2:NP_001247345.1 Gene:CG43124 / 12798282 FlyBaseID:FBgn0262587 Length:245 Species:Drosophila melanogaster


Alignment Length:246 Identity:57/246 - (23%)
Similarity:91/246 - (36%) Gaps:80/246 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PWQAALLTTADVYLGGGALITAQHVLTAAHKVYNLGLTYFK------VRLGE--WDAASTSEPIP 231
            ||.|.:|:.:.| :..||||...:|||||        :.||      ||||.  :|.:       
  Fly    41 PWLAEILSDSKV-ICAGALINNLYVLTAA--------SCFKENEKLTVRLGSGYFDKS------- 89

  Fly   232 AQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCL----------PTTSFVGQR 286
            .::..::..|...:..|.|..|::.|.:|.|.|..  |:.:..:|:          .|...:.::
  Fly    90 YENFRVTKAYFWMTHFPANNTNNLCIFRLQTEVEF--KTHIRPMCITKSPKSLGLATTFEIINEK 152

  Fly   287 CWVAGWGKNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLGSSFVLSPTSFICAGGEAGKDA 351
            ..:..:.||..|....|...|.:                     ..:...||             
  Fly   153 PKMWYFCKNIKGLFCKYVFGENE---------------------EKWQSKPT------------- 183

  Fly   352 CTGDGGSPLVCT-SNGVWYVVGLVAWGIGCAQAG--VPGVYVNVGTYLPWI 399
                 |||...| |||.:  .|||.:||...:..  ...||:||.:::.||
  Fly   184 -----GSPWTETISNGPF--KGLVRYGILSYRDNKTYDEVYINVMSHINWI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13318NP_649831.1 CLIP_1 <91..145 CDD:465709
Tryp_SPc 169..402 CDD:238113 57/246 (23%)
CG43124NP_001247345.1 Tryp_SPc 33..>133 CDD:473915 30/109 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.