DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and CRZ1

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_014371.1 Gene:CRZ1 / 855704 SGDID:S000004972 Length:678 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:67/267 - (25%)
Similarity:102/267 - (38%) Gaps:54/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TPDDD-EVYATYQEIVLEE----PKEEIDDTKVEYDNTYYEVAEGHAGEDDAASLIEEADYDSIM 173
            :||:. :..:..:|.:||.    |..|.|:.:..|||.                  .:..|::|.
Yeast   429 SPDEKAKSISANREKLLEMADLLPSSENDNNRERYDND------------------SKTSYNTIN 475

  Fly   174 AE--DEEQQQTLELDEDTELIVGDVNDAYVYDSDDEVAVLDNVLDDEYEHENIVVKKCSL---PP 233
            :.  :|:......|....::..|.||             :.|.|||..:...|::...||   ..
Yeast   476 SSNFNEDNNNNNLLTSKPKIESGIVN-------------IKNELDDTSKDLGILLDIDSLGQFEQ 527

  Fly   234 KPKVRSDDARRRGTGGVYICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHM 298
            |...::||.......|.:..::..|..|    .:......:....|.|::|..:|.....||.|:
Yeast   528 KVGFKNDDNHENNDNGTFSVKKNDNLEK----LDSVTNNRKNPANFACDVCGKKFTRPYNLKSHL 588

  Fly   299 RKHTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCG---------TCGKAFTTGYILKNHM 354
            |.||.||||.|..||:.|.....|.:||..||.::.||||         .|||.|.....|..|.
Yeast   589 RTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSDALGRHF 653

  Fly   355 LIHSGER 361
            ...||.|
Yeast   654 KTESGRR 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871
C2H2 Zn finger 253..273 CDD:275368 2/19 (11%)
COG5048 276..>331 CDD:227381 22/54 (41%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 293..317 CDD:290200 13/23 (57%)
C2H2 Zn finger 309..329 CDD:275368 7/19 (37%)
zf-H2C2_2 324..346 CDD:290200 12/30 (40%)
C2H2 Zn finger 337..357 CDD:275368 8/28 (29%)
zf-H2C2_2 350..372 CDD:290200 5/12 (42%)
C2H2 Zn finger 365..383 CDD:275368
CRZ1NP_014371.1 COG5048 139..617 CDD:227381 51/222 (23%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
C2H2 Zn finger 599..619 CDD:275368 7/19 (37%)
C2H2 Zn finger 627..655 CDD:275368 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.