Sequence 1: | NP_649825.1 | Gene: | M1BP / 41042 | FlyBaseID: | FBgn0037621 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_174737.2 | Gene: | TT1 / 840386 | AraportID: | AT1G34790 | Length: | 303 | Species: | Arabidopsis thaliana |
Alignment Length: | 269 | Identity: | 59/269 - (21%) |
---|---|---|---|
Similarity: | 86/269 - (31%) | Gaps: | 118/269 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 163 LIEEADYDS--------IMAEDEEQQQTLELDEDTELIVGDV-----------NDA--------- 199
Fly 200 --YVYDSDDEVAVLDNVLDDEYEHENIVVKKCSLPPKP--------------------------- 235
Fly 236 -------KVRSDDARRRGTG-----GV--YIC-EQCGNHI--------KGRMAFELHCRRHRGDK 277
Fly 278 QFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGRCFTDYTTRVKHERT---HTNERPYVCGT 339
Fly 340 CGKAFTTGY 348 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
M1BP | NP_649825.1 | zf-AD | 13..84 | CDD:214871 | |
C2H2 Zn finger | 253..273 | CDD:275368 | 8/28 (29%) | ||
COG5048 | 276..>331 | CDD:227381 | 17/57 (30%) | ||
C2H2 Zn finger | 281..301 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 293..317 | CDD:290200 | 7/23 (30%) | ||
C2H2 Zn finger | 309..329 | CDD:275368 | 7/22 (32%) | ||
zf-H2C2_2 | 324..346 | CDD:290200 | 7/24 (29%) | ||
C2H2 Zn finger | 337..357 | CDD:275368 | 4/12 (33%) | ||
zf-H2C2_2 | 350..372 | CDD:290200 | |||
C2H2 Zn finger | 365..383 | CDD:275368 | |||
TT1 | NP_174737.2 | C2H2 Zn finger | 231..247 | CDD:275368 | 3/15 (20%) |
C2H2 Zn finger | 257..274 | CDD:275368 | 8/35 (23%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 62 | 1.000 | Inparanoid score | I2531 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |