DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and TT1

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_174737.2 Gene:TT1 / 840386 AraportID:AT1G34790 Length:303 Species:Arabidopsis thaliana


Alignment Length:269 Identity:59/269 - (21%)
Similarity:86/269 - (31%) Gaps:118/269 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 LIEEADYDS--------IMAEDEEQQQTLELDEDTELIVGDV-----------NDA--------- 199
            ||:..:.:|        :.||:.||::..|.:||.|:.| |:           |||         
plant    47 LIDRINLNSNLDLNPNPLYAEEGEQEEEEEEEEDREVDV-DLHIGLPGFGKPSNDAKQLKKRNGK 110

  Fly   200 --YVYDSDDEVAVLDNVLDDEYEHENIVVKKCSLPPKP--------------------------- 235
              ..||:...:             ||.:..|....|.|                           
plant   111 EIATYDAGKGI-------------ENELSGKAYWIPAPEQILIGFTHFSCHVCFKTFNRYNNLQM 162

  Fly   236 -------KVRSDDARRRGTG-----GV--YIC-EQCGNHI--------KGRMAFELHCRRHRGDK 277
                   :.|......:||.     |:  |.| |.|.|||        |.....:.|.:|..|.|
plant   163 HMWGHGSQYRKGPESLKGTQPRAMLGIPCYCCVEGCRNHIDHPRSKPLKDFRTLQTHYKRKHGHK 227

  Fly   278 QFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGRCFTDYTTRVKHERT---HTNERPYVCGT 339
            .|.|.||........:.:.| .|:.|:| :.| .||..|       ||:|:   |.         
plant   228 PFSCRLCGKLLAVKGDWRTH-EKNCGKR-WVC-VCGSDF-------KHKRSLKDHV--------- 273

  Fly   340 CGKAFTTGY 348
              |||.:|:
plant   274 --KAFGSGH 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871
C2H2 Zn finger 253..273 CDD:275368 8/28 (29%)
COG5048 276..>331 CDD:227381 17/57 (30%)
C2H2 Zn finger 281..301 CDD:275368 4/19 (21%)
zf-H2C2_2 293..317 CDD:290200 7/23 (30%)
C2H2 Zn finger 309..329 CDD:275368 7/22 (32%)
zf-H2C2_2 324..346 CDD:290200 7/24 (29%)
C2H2 Zn finger 337..357 CDD:275368 4/12 (33%)
zf-H2C2_2 350..372 CDD:290200
C2H2 Zn finger 365..383 CDD:275368
TT1NP_174737.2 C2H2 Zn finger 231..247 CDD:275368 3/15 (20%)
C2H2 Zn finger 257..274 CDD:275368 8/35 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.