DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment M1BP and ZNF28

DIOPT Version :9

Sequence 1:	NP_649825.1	Gene:	M1BP / 41042	FlyBaseID:	FBgn0037621	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_008900.3	Gene:	ZNF28 / 7576	HGNCID:	13073	Length:	718	Species:	Homo sapiens

Alignment Length:	167	Identity:	58/167 - (34%)
Similarity:	87/167 - (52%)	Gaps:	4/167 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   251 YICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGRC 315
            |.|.:||.....:.....|.|.|..:|.:.||.|...|...|.|:||.|.||||:|:.||.|.:.
Human   439 YKCNECGKVFNQQSTLARHHRLHTAEKPYKCEECDKVFRCKSHLERHRRIHTGEKPYKCKVCDKA 503

  Fly   316 FTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLST 380
            |...:...:|:|.||.|:||:|..|||.|:|...|..|..:|:.|:.|:||.|:|.|...:|:..
Human   504 FRSDSCLTEHQRVHTGEKPYMCNECGKVFSTKANLACHHKLHTAEKPYKCEECEKVFSRKSHMER 568

  Fly   381 HFRSGVHKRHLEKAEMKQVLEQEQKRELKEEEEDSLH 417
            |.|  :|..  ||....:|.::..:|:....:...:|
Human   569 HRR--IHTG--EKPYKCKVCDKAFRRDSHLAQHQRVH 601

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
M1BP	NP_649825.1	zf-AD	13..84	CDD:214871
		C2H2 Zn finger	253..273	CDD:275368	5/19 (26%)
		COG5048	276..>331	CDD:227381	22/54 (41%)
		C2H2 Zn finger	281..301	CDD:275368	9/19 (47%)
		zf-H2C2_2	293..317	CDD:290200	12/23 (52%)
		C2H2 Zn finger	309..329	CDD:275368	6/19 (32%)
		zf-H2C2_2	324..346	CDD:290200	12/21 (57%)
		C2H2 Zn finger	337..357	CDD:275368	8/19 (42%)
		zf-H2C2_2	350..372	CDD:290200	9/21 (43%)
		C2H2 Zn finger	365..383	CDD:275368	7/17 (41%)
ZNF28	NP_008900.3	KRAB	8..>48	CDD:214630
		KRAB	8..47	CDD:279668
		COG5048	<143..373	CDD:227381
		C2H2 Zn finger	217..237	CDD:275368
		C2H2 Zn finger	245..265	CDD:275368
		COG5048	267..655	CDD:227381	58/167 (35%)
		C2H2 Zn finger	273..293	CDD:275368
		C2H2 Zn finger	301..321	CDD:275368
		C2H2 Zn finger	329..349	CDD:275368
		zf-H2C2_2	341..366	CDD:290200
		C2H2 Zn finger	357..377	CDD:275368
		zf-H2C2_2	370..394	CDD:290200
		C2H2 Zn finger	385..405	CDD:275368
		zf-H2C2_2	397..422	CDD:290200
		C2H2 Zn finger	413..433	CDD:275368
		zf-H2C2_2	425..450	CDD:290200	4/10 (40%)
		C2H2 Zn finger	441..461	CDD:275368	5/19 (26%)
		C2H2 Zn finger	469..489	CDD:275368	9/19 (47%)
		zf-H2C2_2	481..506	CDD:290200	13/24 (54%)
		C2H2 Zn finger	497..517	CDD:275368	6/19 (32%)
		zf-H2C2_2	510..534	CDD:290200	12/23 (52%)
		C2H2 Zn finger	525..545	CDD:275368	8/19 (42%)
		C2H2 Zn finger	553..573	CDD:275368	8/21 (38%)
		zf-H2C2_2	565..590	CDD:290200	7/28 (25%)
		C2H2 Zn finger	581..601	CDD:275368	2/19 (11%)
		zf-H2C2_2	593..618	CDD:290200	1/9 (11%)
		C2H2 Zn finger	609..629	CDD:275368
		zf-H2C2_2	621..646	CDD:290200
		C2H2 Zn finger	637..657	CDD:275368
		C2H2 Zn finger	665..685	CDD:275368
		zf-H2C2_2	677..702	CDD:290200
		C2H2 Zn finger	693..713	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910