DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and CG31365

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:644 Identity:124/644 - (19%)
Similarity:196/644 - (30%) Gaps:269/644 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKSTCRVCAKYASNKRSPKLFERSNTKMIDNIE--ALTGLRLENYGCLPDQICECCSMELASAVK 71
            |.:.||:|.|  .::.:..:|:..:|::...:.  |...|..:....||.:||:.|..:|..:..
  Fly    10 LATLCRLCLK--EHQDAYAIFDEDDTQLSIPVRLMACVALDAKATDTLPKRICQECRYQLEKSFL 72

  Fly    72 LRERCIAAQREL-----LLG--------------------------------------------- 86
            .|:||..|:::|     |||                                             
  Fly    73 FRQRCQWAEKKLRKHIRLLGLGKRSRVFSKDPDDYDEDELEFEDSIAFIEVQDKVRKLEDEKWRE 137

  Fly    87 ------------------------LTEEQRQGISAFYRAAV---MGEDIVQTVKTPDDD------ 118
                                    ||.|.|:.::...|:.|   :.|::...|:   ||      
  Fly   138 DFKEEQAAEMHKRLVKSRLELRAKLTTELRKELAEEVRSEVRKELAEEVRSQVR---DDLRNEVS 199

  Fly   119 ---------------EVYAT------YQEIVLEEP------------------------------ 132
                           |||.|      ::.:...||                              
  Fly   200 EDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRRPSLVDA 264

  Fly   133 -----------KEE-----------------IDDTKVEYDNTYYEVAEGHAGED-----DAASLI 164
                       |||                 ||..:::      |.....:|||     ...|.:
  Fly   265 NLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELD------EEVPAESGEDFREINMVGSDV 323

  Fly   165 EEAD------YDSIMAEDEEQQQTLELDEDTELI----------------VGDVNDAYVYDSDDE 207
            ...|      .:|..:||:.|..|.|.|:|..:.                ..::.|..|::..:|
  Fly   324 VHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEE 388

  Fly   208 VAVLDNVLDDEYEHENIVV------------------------KKCSLPPKPKVRSDDARRRGTG 248
            ::....|..   .|||:::                        |:.|..|:||.    .|...|.
  Fly   389 ISQEQQVFS---FHENVIIVEKEQNDRDEQTPLKRKRSSELVFKQESSCPQPKT----GRITDTV 446

  Fly   249 GVYICEQC--------------GNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMR 299
            ..:.|..|              ..||||       .:..:|. ...|..|..:....|.|||||.
  Fly   447 KSFQCHLCPVAFPTQKLLTRHHNTHIKG-------LKSGKGG-TLKCPSCALQLSCASSLKRHMI 503

  Fly   300 KHTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHM-LIHSG-ERA 362
            .|||.:||.|..|...|:......:|..|||..:.:.|..|...|.....|:.|: .:|.| .|.
  Fly   504 IHTGLKPFKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRT 568

  Fly   363 YRCELCDKSFM----LPTHLSTHFRSGVHKRHLEKAEMKQVLEQEQKRELKEEEEDSLH 417
            ::|.||.:||.    |..||.||  :||      ....||...|...|...:....::|
  Fly   569 HKCHLCHRSFNHVSGLSRHLVTH--AGV------MFSCKQCGRQFNDRSAVQRHVTTMH 619

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 19/77 (25%)
C2H2 Zn finger 253..273 CDD:275368 6/33 (18%)
COG5048 276..>331 CDD:227381 19/54 (35%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
zf-H2C2_2 293..317 CDD:290200 12/23 (52%)
C2H2 Zn finger 309..329 CDD:275368 4/19 (21%)
zf-H2C2_2 324..346 CDD:290200 7/21 (33%)
C2H2 Zn finger 337..357 CDD:275368 5/20 (25%)
zf-H2C2_2 350..372 CDD:290200 8/23 (35%)
C2H2 Zn finger 365..383 CDD:275368 10/21 (48%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871 19/74 (26%)
vATP-synt_E 109..>244 CDD:304907 16/137 (12%)
RRF <161..222 CDD:294170 14/63 (22%)
zf-C2H2_8 454..530 CDD:292531 22/83 (27%)
C2H2 Zn finger 485..505 CDD:275368 8/19 (42%)
zf-H2C2_2 497..522 CDD:290200 13/24 (54%)
C2H2 Zn finger 513..533 CDD:275368 4/19 (21%)
zf-H2C2_2 526..550 CDD:290200 7/23 (30%)
C2H2 Zn finger 541..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 571..591 CDD:275368 8/19 (42%)
C2H2 Zn finger 598..617 CDD:275368 4/18 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.