DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and CG4936

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:502 Identity:134/502 - (26%)
Similarity:183/502 - (36%) Gaps:147/502 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLRERCI 77
            ||||.:......:....:.|...:...|....|:.::.:...||:|||.|...|..|.|.||.|.
  Fly    23 CRVCLQQPKEPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRETCQ 87

  Fly    78 AAQREL--LLGLTE-EQRQGISAFYRAAVMGEDIVQTVKTPDDDEVYATYQEIVLEEPKEEIDDT 139
            .:...|  .:|..| |||.........|...|..|.    ||:.|          :||:.:.:|.
  Fly    88 RSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVD----PDEAE----------QEPEHDEEDE 138

  Fly   140 KVEYDNTYYEVAEGHAGEDDAA----SLIEEADYDSIMAEDEEQQ----QTLELDEDTELIVGDV 196
            .|:.|.::|      |..||||    .:..:...|.|:.|.|:.:    :..:::||.  |:.:|
  Fly   139 DVDLDESHY------AEADDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDG--IIEEV 195

  Fly   197 NDAY-VYDSD--------------------DEVAVLDNVLDD---EYEHENIV------VKKCSL 231
            .|.| .|:.|                    .|:..||.|..|   |..||:..      .::..:
  Fly   196 YDVYETYEGDLIPDQGYDHEMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFV 260

  Fly   232 PPKPKVRSDDAR-------------------------------------RRGT------------ 247
            |.|....|..||                                     |||.            
  Fly   261 PSKSVRASIHARNATKRRVNPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKS 325

  Fly   248 --------------------GG-----------VYICEQCGNHIKGRMAFELHCRRHRGDKQFGC 281
                                ||           .|||:.|||....:.....|.:.|.|.|...|
  Fly   326 EKDISIGEVLARKHSGIKTKGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHEC 390

  Fly   282 ELCQSRFCTTSELKRHMRKHTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTT 346
            |:|...|....:|.|||..|||.||:.|.||...|.|.:||.||.|.|||||||.|..|.|.||.
  Fly   391 EICGHCFAQAQQLARHMNTHTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTY 455

  Fly   347 GYILKNHMLIHSGERAYRCELCDKSF----MLPTHLSTHFRSGVHKR 389
            ...||.|.:||:||:.:.|::|.|.|    .|..|...|.|.|...|
  Fly   456 TNTLKFHKMIHTGEKPHVCDVCGKGFPQAYKLRNHRVIHERRGQSAR 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 20/72 (28%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
COG5048 276..>331 CDD:227381 25/54 (46%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
zf-H2C2_2 293..317 CDD:290200 12/23 (52%)
C2H2 Zn finger 309..329 CDD:275368 10/19 (53%)
zf-H2C2_2 324..346 CDD:290200 14/21 (67%)
C2H2 Zn finger 337..357 CDD:275368 8/19 (42%)
zf-H2C2_2 350..372 CDD:290200 10/21 (48%)
C2H2 Zn finger 365..383 CDD:275368 7/21 (33%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 20/71 (28%)
C2H2 Zn finger 362..382 CDD:275368 5/19 (26%)
zf-H2C2_2 375..399 CDD:290200 8/23 (35%)
COG5048 386..>447 CDD:227381 31/60 (52%)
C2H2 Zn finger 390..410 CDD:275368 8/19 (42%)
zf-H2C2_2 403..426 CDD:290200 12/22 (55%)
C2H2 Zn finger 418..438 CDD:275368 10/19 (53%)
zf-H2C2_2 432..455 CDD:290200 14/22 (64%)
C2H2 Zn finger 446..466 CDD:275368 8/19 (42%)
zf-H2C2_2 459..481 CDD:290200 10/21 (48%)
C2H2 Zn finger 474..494 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11976
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I3338
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.