DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and CG17801

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650660.2 Gene:CG17801 / 42144 FlyBaseID:FBgn0038550 Length:381 Species:Drosophila melanogaster


Alignment Length:438 Identity:109/438 - (24%)
Similarity:167/438 - (38%) Gaps:109/438 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 STCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLRER 75
            |.|.:||....:.....:|   ..:::..|:.|||:.||.....|..||..|..:|.:::||::|
  Fly     8 SQCHLCASCFCHLNPTIIF---CLEVLAKIKDLTGIWLEQNERQPRHICPSCLNDLNTSIKLKKR 69

  Fly    76 CIAAQRELLLGLTEEQRQGISAFYRAAVMGEDIVQTVKTPDDDEVYATYQEIVLEEPKEEIDDTK 140
            ......|..|    .:..|:                     |:::.:|..:|   ||:.:..|.:
  Fly    70 IQRVHNEATL----RRESGL---------------------DEDLESTVSDI---EPEGDSSDLE 106

  Fly   141 VE--YDNTYYEVAEGHAGEDDAASLIEEADYDSIMA-EDEEQQQTLELDEDTELIVGDVNDAYVY 202
            .|  ||:..|..       |..|   ||:|.|..:| ||...:.....|.:|.||....|..   
  Fly   107 SEESYDSENYPF-------DKKA---EESDIDLNLAHEDRRNEPHNPYDSETPLIFKHKNPL--- 158

  Fly   203 DSDDEVAVLDNVLDDEYEHENI-------------------------------VVKKCSLPPK-- 234
                       :....:.:||:                               |||..:|.|:  
  Fly   159 -----------IETPSFANENLPNKVDAKSPKKGNFIQIGTDLRLLTTYPSIKVVKPLALAPEDV 212

  Fly   235 ------PKVRSDDARRRGTGGVYICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSE 293
                  |..|:  ||:..:   .:|.:||...|.....:.|..||.|:|.|.|..|..||.|...
  Fly   213 AAENVPPAKRT--ARKMQS---LVCPKCGRVFKTPYNLKTHMVRHTGEKNFPCTFCDKRFVTKYL 272

  Fly   294 LKRHMR-KHTGERPFACKYCGRCFTDYTTRVKHER-THTNERPYVCGTCGKAFTTGYILKNHMLI 356
            .:.|.| :|.||:||.|.:|...|...|.:..||| .|..:..|.|..|.|.|.|...|..|..:
  Fly   273 ARLHERVRHMGEQPFECNFCSATFFTSTAKSSHERIRHIRDLRYQCDQCTKRFNTKTCLNKHKFL 337

  Fly   357 HSGERAYRCELCDKSFMLPTHLSTHFRSGVHKRHLEKAEMKQVLEQEQ 404
            |||.:.:.|.:|..:|.....|.:||.|..|::     ....:||.|:
  Fly   338 HSGLKPFDCVICQINFARKATLRSHFDSVAHQK-----RASAILESEE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 19/70 (27%)
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
COG5048 276..>331 CDD:227381 22/56 (39%)
C2H2 Zn finger 281..301 CDD:275368 7/20 (35%)
zf-H2C2_2 293..317 CDD:290200 9/24 (38%)
C2H2 Zn finger 309..329 CDD:275368 7/20 (35%)
zf-H2C2_2 324..346 CDD:290200 9/22 (41%)
C2H2 Zn finger 337..357 CDD:275368 7/19 (37%)
zf-H2C2_2 350..372 CDD:290200 7/21 (33%)
C2H2 Zn finger 365..383 CDD:275368 5/17 (29%)
CG17801NP_650660.2 zf-AD 9..74 CDD:285071 18/67 (27%)
zf-C2H2 231..252 CDD:278523 5/20 (25%)
C2H2 Zn finger 232..252 CDD:275368 5/19 (26%)
zf-H2C2_2 244..269 CDD:290200 10/24 (42%)
C2H2 Zn finger 260..281 CDD:275368 7/20 (35%)
C2H2 Zn finger 289..308 CDD:275368 6/18 (33%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
C2H2 Zn finger 346..362 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.