DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and CG6808

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001247055.1 Gene:CG6808 / 41394 FlyBaseID:FBgn0037921 Length:375 Species:Drosophila melanogaster


Alignment Length:414 Identity:117/414 - (28%)
Similarity:174/414 - (42%) Gaps:69/414 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 STCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLRER 75
            |.||.|.|..:......|||.:..|:   :.:..|..::....||||||..|.|:|....:....
  Fly     8 SMCRTCRKKGTQSTLQSLFESNAHKL---LISYAGTSVKPDDGLPDQICTVCLMQLEEVDRFLSA 69

  Fly    76 CIAAQRELLLGLTEEQRQGISAFYRAAVMGEDIVQTVKTPDDDEVYATYQEIVLEEP----KEEI 136
            |..:... |..|..:.....|||           :|::..|.           ||:.    |:.|
  Fly    70 CKQSDAH-LRSLVRQTLSSASAF-----------ETLEDKDQ-----------LEQKKRARKQNI 111

  Fly   137 DDTKVEYDNTYYEVAEG--HAGEDDAASLIEEADYD-----SIMAEDEE---QQQTLELDEDTEL 191
            ....:|.:...::..|.  ...:||....|.:...|     ::.||:|:   |:.....|.|.:.
  Fly   112 SGRLIEENPINFKTQENALETTKDDEILPINKFSSDFVFDLNVNAENEKDIHQEDYTISDMDLDR 176

  Fly   192 IVGDVNDAYVYDSDDEVAVLDNVLDDEYEHENI------VVK---KCSLPPKPKVRSDDARRRGT 247
            .:.|.|.:..| |.:..|..|::.:...::.|:      |:.   .|. |.|             
  Fly   177 EISDQNYSETY-SQESSAATDSIQETSEDYHNLEPSADYVIDLGVACE-PDK------------- 226

  Fly   248 GGVYICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYC 312
               |.|:.|.|..:.......|.:.||.:|...||:||..|.....||.|||.||||:|:.|.||
  Fly   227 ---YRCKICSNTYRCLSQLNAHSQVHRKEKDHQCEVCQKTFRAACNLKTHMRTHTGEKPYQCCYC 288

  Fly   313 GRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTH 377
            .|.|.|.:|..||||.|||||||.|..|||.|:.......|..:||.|::::|.:|.|.|.|...
  Fly   289 SRRFADNSTHRKHERLHTNERPYACNICGKTFSLSSSRNAHYYLHSSEKSHKCLMCKKEFRLKHQ 353

  Fly   378 LSTHFRSGVHKRHLEKAEMKQVLE 401
            |:.|.:|..|:  |...|...|:|
  Fly   354 LTAHEKSLAHR--LIAKEYSDVVE 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 19/70 (27%)
C2H2 Zn finger 253..273 CDD:275368 4/19 (21%)
COG5048 276..>331 CDD:227381 28/54 (52%)
C2H2 Zn finger 281..301 CDD:275368 10/19 (53%)
zf-H2C2_2 293..317 CDD:290200 14/23 (61%)
C2H2 Zn finger 309..329 CDD:275368 11/19 (58%)
zf-H2C2_2 324..346 CDD:290200 16/21 (76%)
C2H2 Zn finger 337..357 CDD:275368 6/19 (32%)
zf-H2C2_2 350..372 CDD:290200 7/21 (33%)
C2H2 Zn finger 365..383 CDD:275368 7/17 (41%)
CG6808NP_001247055.1 zf-AD 9..79 CDD:214871 20/73 (27%)
C2H2 Zn finger 229..249 CDD:275368 4/19 (21%)
zf-C2H2 255..277 CDD:278523 10/21 (48%)
C2H2 Zn finger 257..277 CDD:275368 10/19 (53%)
zf-H2C2_2 269..293 CDD:290200 14/23 (61%)
C2H2 Zn finger 285..305 CDD:275368 11/19 (58%)
zf-H2C2_2 299..321 CDD:290200 15/21 (71%)
C2H2 Zn finger 313..333 CDD:275368 6/19 (32%)
C2H2 Zn finger 341..359 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I3338
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.