DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and CG14710

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_650092.4 Gene:CG14710 / 41393 FlyBaseID:FBgn0037920 Length:415 Species:Drosophila melanogaster


Alignment Length:434 Identity:116/434 - (26%)
Similarity:181/434 - (41%) Gaps:92/434 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CRVCAKYASNKRSPKLF-ERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLRERC 76
            ||:|.......:...|| ::..:.:...:|....:|:.....||::.|..|...:......|:.|
  Fly    10 CRICLGDFEESQMICLFGDKGESDLRKKLELCCRIRVRQSPQLPEKACNSCCEFVQMWFNFRQMC 74

  Fly    77 IAAQRELLLGLTEEQRQGISAFYRAAVMGEDIVQTVKTPDDDEVYATYQEIVLE-----EPKEEI 136
            :.:|                 .|......|......:..|.:.:...|:.:.|:     :.||||
  Fly    75 LNSQ-----------------VYWETSSSERPEALAQASDAEYMLYLYENLHLKLGTENQEKEEI 122

  Fly   137 DDTKVEYDNTYYEVAEGHAGEDDAASLIEEADYDSIM----AEDEEQQQTLELDEDTELIVGDVN 197
              |.:|         ||...::|.:.  |..|::..:    .|::|:..|    |..|.|:....
  Fly   123 --TAIE---------EGDEQQEDQSQ--EVLDFNGFIINESIEEDEEPNT----ESPEQILISHM 170

  Fly   198 DAYVYDSDDEVAVLDNVLDD-----------------EYEHENIVV--------------KKCSL 231
            |:||.|..     ::.::||                 ||..|.:::              :|...
  Fly   171 DSYVDDQQ-----MEELIDDKGELVEELSNANTFYEVEYGDEELLMSSAPSPHPSFKMDKQKPGR 230

  Fly   232 PPKP------KVRSDDARRRGT------GGVYICEQCGNHIKGRMAFELHCRRHRGDKQFGCELC 284
            |.||      |.:..:|:.||.      ...::|..|||....:..|..|...|...|...||:|
  Fly   231 PRKPDAELKFKRKDINAKERGNQPKCKEEEKFMCILCGNVFYKKSVFTAHMMTHSEYKPHQCEIC 295

  Fly   285 QSRFCTTSELKRHMRKHTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYI 349
            ...|....||:.|:|:|||:||:.|.||.|.|.|.:.||:|||.|||.|||.|..|||.||...|
  Fly   296 NKSFRQMGELRAHIRRHTGDRPYKCMYCDRHFYDRSERVRHERVHTNTRPYACQECGKTFTHTAI 360

  Fly   350 LKNHMLIHSGERAYRCELCDKSFMLPTHLSTHFRSGVHKRHLEK 393
            ||||:|.||.::.|.|.:|.|||.|...|..|.::..|:..:|:
  Fly   361 LKNHILSHSAQKNYNCGICCKSFTLLHQLKAHLQTLTHRNKMEQ 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 14/71 (20%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
COG5048 276..>331 CDD:227381 26/54 (48%)
C2H2 Zn finger 281..301 CDD:275368 8/19 (42%)
zf-H2C2_2 293..317 CDD:290200 13/23 (57%)
C2H2 Zn finger 309..329 CDD:275368 11/19 (58%)
zf-H2C2_2 324..346 CDD:290200 14/21 (67%)
C2H2 Zn finger 337..357 CDD:275368 12/19 (63%)
zf-H2C2_2 350..372 CDD:290200 11/21 (52%)
C2H2 Zn finger 365..383 CDD:275368 8/17 (47%)
CG14710NP_650092.4 zf-AD 9..83 CDD:285071 15/89 (17%)
COG5048 <261..395 CDD:227381 61/133 (46%)
C2H2 Zn finger 264..284 CDD:275368 6/19 (32%)
zf-C2H2 290..312 CDD:278523 8/21 (38%)
C2H2 Zn finger 292..312 CDD:275368 8/19 (42%)
zf-H2C2_2 304..327 CDD:290200 13/22 (59%)
C2H2 Zn finger 320..340 CDD:275368 11/19 (58%)
zf-H2C2_2 335..357 CDD:290200 14/21 (67%)
C2H2 Zn finger 348..368 CDD:275368 12/19 (63%)
C2H2 Zn finger 376..395 CDD:275368 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I11976
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.