DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and nom

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:394 Identity:116/394 - (29%)
Similarity:170/394 - (43%) Gaps:81/394 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LKSTCRVCAKYASNKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCSMELASAVKLR 73
            |.:.||||.:.....::.:||:.....::..|:.:||:.|:.....||.:|.||..:|.||:..|
  Fly     2 LINVCRVCGRSRLCPKAVELFKPGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSAMIFR 66

  Fly    74 ERCIAAQRELLLGLTEEQRQGISAFYRAAVMGEDIVQTVKTPDDDEVYATYQEIVLEEPKEEIDD 138
            .:||..|:: .:.|.:..:.|.|                                 ||.|.|.:|
  Fly    67 RQCILQQKK-WVPLLQSDKVGAS---------------------------------EEKKVEPND 97

  Fly   139 TKVEYDNTY---------YEVAEGHAGEDDAASLIEEADYDSIMAEDEEQQQTLELDEDTELIVG 194
            ...:...|.         .|:.:.....:..||..|....|       |..|.:|:..:.:....
  Fly    98 PSTKKKTTKRRRGRPRMPLEIVDIVVTNESKASAGESVGGD-------EFDQPVEISNEPDATDS 155

  Fly   195 DVNDAYVYDSDDEVAVLDNVLDDEYEHENIVVKKCSLPPKPKVRSDDARRRGTGGVYICEQCGNH 259
            |||...: |..||     :.|:.:::..|:.:.|                        |:.||..
  Fly   156 DVNLEEI-DLPDE-----DGLESDHDLPNVQIHK------------------------CDTCGII 190

  Fly   260 IKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRH-MRKHTGERPFACKYCGRCFTDYTTRV 323
            ...:.:...|...|.|.:.:.|:.|...|...||||.| :..||.|.||||:||.|.:.....|.
  Fly   191 KNNKSSLVRHQFEHNGIRPYPCKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRK 255

  Fly   324 KHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLSTHFRSGVHK 388
            ||||.||||||:||..||||||...|||.||.:|...|.|.|::||:||.|..||:|||.|..||
  Fly   256 KHERVHTNERPFVCDQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHK 320

  Fly   389 RHLE 392
            |:.|
  Fly   321 RNAE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 22/70 (31%)
C2H2 Zn finger 253..273 CDD:275368 4/19 (21%)
COG5048 276..>331 CDD:227381 24/55 (44%)
C2H2 Zn finger 281..301 CDD:275368 8/20 (40%)
zf-H2C2_2 293..317 CDD:290200 14/24 (58%)
C2H2 Zn finger 309..329 CDD:275368 9/19 (47%)
zf-H2C2_2 324..346 CDD:290200 17/21 (81%)
C2H2 Zn finger 337..357 CDD:275368 12/19 (63%)
zf-H2C2_2 350..372 CDD:290200 10/21 (48%)
C2H2 Zn finger 365..383 CDD:275368 10/17 (59%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871 22/71 (31%)
C2H2 Zn finger 184..204 CDD:275368 4/19 (21%)
C2H2 Zn finger 212..261 CDD:275368 23/48 (48%)
zf-H2C2_2 255..278 CDD:290200 17/22 (77%)
C2H2 Zn finger 269..289 CDD:275368 12/19 (63%)
zf-H2C2_2 282..305 CDD:290200 11/22 (50%)
C2H2 Zn finger 297..313 CDD:275368 8/15 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447751
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 1 1.100 - - P PTHR24388
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.