DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and pita

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita / 37730 FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster


Alignment Length:492 Identity:113/492 - (22%)
Similarity:189/492 - (38%) Gaps:134/492 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KSALKHLKSTCRVC---AKYAS-NKRSPKLFERSNTKMIDNIEALTGLRLENYGCLPDQICECCS 63
            :.|:...|..||.|   .|.|| .:.:|::...:|..:  .|.|:|.:.:.....:|..||..|.
  Fly     8 REAMLTEKRVCRFCLTEQKLASIFEENPRVKTTANLPL--QIMAITAIEVYAGDGMPGHICLECR 70

  Fly    64 MELASAVKLRERCIAAQRELLL---GLT-------EEQRQGIS--AFYRAAVMGEDIVQTVKTPD 116
            :......:.::.|..|  |.||   .||       |:.|..::  |..:..|:.....:..:||.
  Fly    71 LLFEHCYRFKQMCKRA--ETLLRQYPLTGNWPSPLEKPRAPMTMVASKKLLVVPAKTAEPSETPK 133

  Fly   117 D--DEVYATYQEIVLEE----------PKEEIDDTKVEYDNTYYEVAEGHAGE---DDAASLIEE 166
            .  :.:..:..::::|:          |:.....:.|...:..||:...:..|   ||..|::|:
  Fly   134 KLLNTMAKSSSQVIIEDVQVLESAMVTPRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLED 198

  Fly   167 ADYDSIMAEDEEQQ-----------QTLELDEDTELIVGDVNDAYV----------YDSDDEVAV 210
                  ||.:.|::           :...|::.:..|:.....|.|          .|....||:
  Fly   199 ------MASELEKEFPDIPQKASPVKPKVLNKSSIRILNKGPAAPVEPRLATPKVKRDDSGNVAI 257

  Fly   211 LDNVLDDE--YEHENIVVKKCSLPPKPKVRSDDARRRGTGGVYICEQCGNHIKGRMAFELHCRRH 273
            :..|||.:  .:.::...|...     ||.:|         |:.|..|......:...|:|...|
  Fly   258 VTEVLDSDLPLDDQDDPTKNAE-----KVATD---------VFPCPDCERSFPLQQLLEIHRLNH 308

  Fly   274 RGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGRCFTDYTTRVKHERTHTN------- 331
            ...:.|.|.||:..|.:..:|.:|...|||||||.|..|.:.||......:||||||:       
  Fly   309 TRSRSFQCLLCEKSFFSKYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICV 373

  Fly   332 ---------------------ERPYVCGTCGK----------------------------AFTTG 347
                                 :||:.||.|.|                            :|:|.
  Fly   374 YCEKPFLSRQEMEKHAERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTA 438

  Fly   348 YILKNHMLIHSGERAYRCELCDKSFMLPTHLSTHFRS 384
            ..|..|::.|:|:|||.|:.|.||:||..|||.|.|:
  Fly   439 SKLARHLVAHAGKRAYPCKYCHKSYMLSHHLSRHLRT 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871 18/74 (24%)
C2H2 Zn finger 253..273 CDD:275368 4/19 (21%)
COG5048 276..>331 CDD:227381 23/54 (43%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 293..317 CDD:290200 11/23 (48%)
C2H2 Zn finger 309..329 CDD:275368 7/19 (37%)
zf-H2C2_2 324..346 CDD:290200 13/77 (17%)
C2H2 Zn finger 337..357 CDD:275368 8/47 (17%)
zf-H2C2_2 350..372 CDD:290200 10/21 (48%)
C2H2 Zn finger 365..383 CDD:275368 10/17 (59%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871 20/78 (26%)
COG5048 <281..506 CDD:227381 58/204 (28%)
C2H2 Zn finger 288..308 CDD:275368 4/19 (21%)
C2H2 Zn finger 316..336 CDD:275368 6/19 (32%)
zf-H2C2_2 328..353 CDD:290200 12/24 (50%)
C2H2 Zn finger 344..364 CDD:275368 7/19 (37%)
C2H2 Zn finger 372..388 CDD:275370 0/15 (0%)
C2H2 Zn finger 400..420 CDD:275368 4/19 (21%)
C2H2 Zn finger 428..448 CDD:275368 4/19 (21%)
C2H2 Zn finger 456..476 CDD:275368 11/20 (55%)
C2H2 Zn finger 486..506 CDD:275368
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 1 0.950 - 0 Normalized mean entropy S3885
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.