DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment M1BP and sna

DIOPT Version :9

Sequence 1:	NP_649825.1	Gene:	M1BP / 41042	FlyBaseID:	FBgn0037621	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_476732.1	Gene:	sna / 34908	FlyBaseID:	FBgn0003448	Length:	390	Species:	Drosophila melanogaster

Alignment Length:	139	Identity:	43/139 - (30%)
Similarity:	61/139 - (43%)	Gaps:	9/139 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   253 CEQCGNHIKGRMAFELHCRRH-------RGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACK 310
            |::|.......|....|.:.|       :..|...||.|...:.|...||.|:|.||  .|..|.
  Fly   247 CDECQKMYSTSMGLSKHRQFHCPAAECNQEKKTHSCEECGKLYTTIGALKMHIRTHT--LPCKCP 309

  Fly   311 YCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLP 375
            .||:.|:.......|.||||.|:|:.|..|.::|.....|:.|...|...:.|.|::|.|||...
  Fly   310 ICGKAFSRPWLLQGHIRTHTGEKPFQCPDCPRSFADRSNLRAHQQTHVDVKKYACQVCHKSFSRM 374

  Fly   376 THLSTHFRS 384
            :.|:.|..|
  Fly   375 SLLNKHSSS 383

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
M1BP	NP_649825.1	zf-AD	13..84	CDD:214871
		C2H2 Zn finger	253..273	CDD:275368	4/19 (21%)
		COG5048	276..>331	CDD:227381	20/54 (37%)
		C2H2 Zn finger	281..301	CDD:275368	8/19 (42%)
		zf-H2C2_2	293..317	CDD:290200	10/23 (43%)
		C2H2 Zn finger	309..329	CDD:275368	6/19 (32%)
		zf-H2C2_2	324..346	CDD:290200	10/21 (48%)
		C2H2 Zn finger	337..357	CDD:275368	5/19 (26%)
		zf-H2C2_2	350..372	CDD:290200	7/21 (33%)
		C2H2 Zn finger	365..383	CDD:275368	7/17 (41%)
sna	NP_476732.1	C2H2 Zn finger	308..328	CDD:275368	6/19 (32%)
		zf-H2C2_2	321..344	CDD:290200	9/22 (41%)
		zf-C2H2	334..356	CDD:278523	5/21 (24%)
		C2H2 Zn finger	336..356	CDD:275368	5/19 (26%)
		zf-H2C2_2	348..373	CDD:290200	9/24 (38%)
		C2H2 Zn finger	364..380	CDD:275368	6/15 (40%)
		C2H2 Zn finger	247..267	CDD:275368	4/19 (21%)
		C2H2 Zn finger	282..302	CDD:275368	8/19 (42%)
		zf-C2H2	306..328	CDD:278523	6/21 (29%)
		COG5048	307..>356	CDD:227381	16/48 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	P	PTHR24388
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	1.100