Sequence 1: | NP_649825.1 | Gene: | M1BP / 41042 | FlyBaseID: | FBgn0037621 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001180481.1 | Gene: | ZNF850 / 342892 | HGNCID: | 27994 | Length: | 1090 | Species: | Homo sapiens |
Alignment Length: | 136 | Identity: | 58/136 - (42%) |
---|---|---|---|
Similarity: | 78/136 - (57%) | Gaps: | 8/136 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 251 YICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGRC 315
Fly 316 FTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLST 380
Fly 381 HFRSGV 386 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |