DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and Zfp341

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_955008.2 Gene:Zfp341 / 228807 MGIID:2682937 Length:846 Species:Mus musculus


Alignment Length:335 Identity:75/335 - (22%)
Similarity:111/335 - (33%) Gaps:94/335 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 TYQEIVLEEPKEEIDDTKV--EYDNTYYEVAEGHAGEDDAASLIEEADYDSIMAEDEEQQQTLEL 185
            |.|.:.|...::|.:||.:  ...:|....|...||||:              .:..|.:|.:.:
Mouse   388 TVQVMALNPNRQEEEDTGLGQSLSSTTQPQALPTAGEDE--------------GDKPEAKQVVLI 438

  Fly   186 DED-----------------TELIVGDVNDAY---VYDSDDEVAVLDNVLDDEYEHENIVVKKC- 229
            |..                 :.:|.......|   |.........||..|:....|:..:..:| 
Mouse   439 DSSYLCQFCPSKFSTYFQLKSHMIQHKKEQVYKCVVKSCAQMFPKLDTFLEHIRSHQEELSYRCH 503

  Fly   230 -------------------SLPPKPKVRSDDARRRGTGGVYICEQCGNHIKGRMAFELH------ 269
                               ||.|:...:.|..       ||.|.:|.|......|.|.|      
Mouse   504 LCSKDFPSLYDLGVHQYSHSLLPQHSPKKDST-------VYKCVKCVNKYSTPEALEHHVQTATH 561

  Fly   270 ------------CRR--------HRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGR 314
                        |.|        |....:|.|::|:..|.....||.|...|:||:|:.|..|..
Mouse   562 SFPCPHCQKVFPCERYLRRHLPTHGSGGRFRCQICKKFFRKEHYLKLHAHIHSGEKPYKCSVCES 626

  Fly   315 CFTDYTTRVKHERTHTNERPYVC-----GTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFML 374
            .|.......:|...|...:.|.|     ..|.|.|.....||.|:|.|:|.:.::|.||.|||..
Mouse   627 AFNRKDKLKRHMLIHEPFKKYKCPFSMHTGCSKEFNRQDKLKAHILSHAGLKLHKCGLCSKSFSR 691

  Fly   375 PTHLSTHFRS 384
            ..||:.|.|:
Mouse   692 RAHLAEHQRA 701

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871
C2H2 Zn finger 253..273 CDD:275368 8/45 (18%)
COG5048 276..>331 CDD:227381 16/54 (30%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 293..317 CDD:290200 9/23 (39%)
C2H2 Zn finger 309..329 CDD:275368 4/19 (21%)
zf-H2C2_2 324..346 CDD:290200 7/26 (27%)
C2H2 Zn finger 337..357 CDD:275368 8/24 (33%)
zf-H2C2_2 350..372 CDD:290200 10/21 (48%)
C2H2 Zn finger 365..383 CDD:275368 9/17 (53%)
Zfp341NP_955008.2 COG5048 321..726 CDD:227381 75/335 (22%)
zf-C2H2 321..342 CDD:278523
C2H2 Zn finger 322..342 CDD:275368
zf-H2C2_2 334..359 CDD:290200
C2H2 Zn finger 350..370 CDD:275368
C2H2 Zn finger 444..464 CDD:275368 1/19 (5%)
C2H2 Zn finger 472..494 CDD:275368 4/21 (19%)
C2H2 Zn finger 502..522 CDD:275368 1/19 (5%)
C2H2 Zn finger 539..561 CDD:275370 6/21 (29%)
C2H2 Zn finger 565..585 CDD:275368 2/19 (11%)
C2H2 Zn finger 593..613 CDD:275368 6/19 (32%)
zf-H2C2_2 605..630 CDD:290200 10/24 (42%)
C2H2 Zn finger 621..641 CDD:275368 4/19 (21%)
C2H2 Zn finger 649..674 CDD:275368 8/24 (33%)
C2H2 Zn finger 682..702 CDD:275368 10/20 (50%)
C2H2 Zn finger 710..727 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.