DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and ZNF485

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001305069.1 Gene:ZNF485 / 220992 HGNCID:23440 Length:441 Species:Homo sapiens


Alignment Length:133 Identity:53/133 - (39%)
Similarity:70/133 - (52%) Gaps:4/133 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 CEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGRCFT 317
            |.:||...:.......|.|.|.|.|.:.|..|...|...:.|.||.|.|:||:||.|..|||.|.
Human   216 CIECGKTFRKNSILLSHQRIHTGQKPYKCNDCGKAFAQNAALTRHERIHSGEKPFKCNKCGRAFR 280

  Fly   318 DYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPT----HL 378
            |.:|.::|::.||.|:||.|..|||||.....|.:|..:|:||:.|.|..|.|||...:    |.
Human   281 DNSTVLEHQKIHTGEKPYQCNECGKAFRKSSTLISHQRMHTGEKPYHCSKCGKSFRYSSSFAGHQ 345

  Fly   379 STH 381
            .||
Human   346 KTH 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
COG5048 276..>331 CDD:227381 22/54 (41%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 293..317 CDD:290200 13/23 (57%)
C2H2 Zn finger 309..329 CDD:275368 8/19 (42%)
zf-H2C2_2 324..346 CDD:290200 12/21 (57%)
C2H2 Zn finger 337..357 CDD:275368 8/19 (42%)
zf-H2C2_2 350..372 CDD:290200 9/21 (43%)
C2H2 Zn finger 365..383 CDD:275368 8/21 (38%)
ZNF485NP_001305069.1 KRAB 11..71 CDD:214630
KRAB 11..50 CDD:279668
COG5048 <124..361 CDD:227381 53/133 (40%)
C2H2 Zn finger 132..152 CDD:275368
C2H2 Zn finger 160..180 CDD:275368
C2H2 Zn finger 188..208 CDD:275368
C2H2 Zn finger 216..236 CDD:275368 5/19 (26%)
zf-H2C2_2 229..253 CDD:290200 8/23 (35%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
zf-H2C2_2 256..279 CDD:290200 13/22 (59%)
C2H2 Zn finger 272..292 CDD:275368 8/19 (42%)
zf-H2C2_2 287..307 CDD:290200 10/19 (53%)
C2H2 Zn finger 300..320 CDD:275368 8/19 (42%)
zf-H2C2_2 313..337 CDD:290200 11/23 (48%)
C2H2 Zn finger 328..348 CDD:275368 6/19 (32%)
C2H2 Zn finger 356..376 CDD:275368
zf-H2C2_2 372..393 CDD:290200
C2H2 Zn finger 384..404 CDD:275368
zf-H2C2_2 397..419 CDD:290200
C2H2 Zn finger 412..432 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.