DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and klf-3

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001022205.1 Gene:klf-3 / 191713 WormBaseID:WBGene00003480 Length:315 Species:Caenorhabditis elegans


Alignment Length:148 Identity:51/148 - (34%)
Similarity:70/148 - (47%) Gaps:32/148 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 RMAFELHCRRHRGDKQFGCELCQSR----FCTTSE---LKRHMRKHTGER--------PFACKYC 312
            :|...:|...|.|      ||..:|    ..|:||   |:|..|..:.:|        ..||.|.
 Worm   177 KMEIPMHPLPHNG------ELDSTRSSPSSTTSSERSPLQRKSRIESNKRNPTDKKFVVHACTYP 235

  Fly   313 GRCFTDY--TTRVK-HERTHTNERPYVC--GTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSF 372
            | ||..|  ::.:| |||||:.|:|:||  ..|...|.....|..||..|:|::.:||.|||::|
 Worm   236 G-CFKKYSKSSHLKAHERTHSGEKPFVCKWQNCSWKFARSDELTRHMRKHTGDKPFRCSLCDRNF 299

  Fly   373 MLPTHLSTHFRSGVHKRH 390
            ....|||.|.     |||
 Worm   300 ARSDHLSLHM-----KRH 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871
C2H2 Zn finger 253..273 CDD:275368 2/9 (22%)
COG5048 276..>331 CDD:227381 23/72 (32%)
C2H2 Zn finger 281..301 CDD:275368 9/26 (35%)
zf-H2C2_2 293..317 CDD:290200 10/34 (29%)
C2H2 Zn finger 309..329 CDD:275368 10/22 (45%)
zf-H2C2_2 324..346 CDD:290200 12/24 (50%)
C2H2 Zn finger 337..357 CDD:275368 6/21 (29%)
zf-H2C2_2 350..372 CDD:290200 10/21 (48%)
C2H2 Zn finger 365..383 CDD:275368 9/17 (53%)
klf-3NP_001022205.1 C2H2 Zn finger 235..254 CDD:275368 8/19 (42%)
C2H2 Zn finger 262..284 CDD:275368 6/21 (29%)
zf-H2C2_2 276..301 CDD:290200 11/24 (46%)
C2H2 Zn finger 292..312 CDD:275368 10/24 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.