| Sequence 1: | NP_649825.1 | Gene: | M1BP / 41042 | FlyBaseID: | FBgn0037621 | Length: | 418 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001023313.1 | Gene: | M03D4.4 / 177375 | WormBaseID: | WBGene00019751 | Length: | 505 | Species: | Caenorhabditis elegans |
| Alignment Length: | 213 | Identity: | 61/213 - (28%) |
|---|---|---|---|
| Similarity: | 91/213 - (42%) | Gaps: | 14/213 - (6%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 170 DSIMAEDEEQQQTLELDEDTELIVGDVNDAYVYDSDDEVAVLDNVLDDEYEHENIVVKKCSL-PP 233
Fly 234 KPKVRSDDARRRGTGGVYICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHM 298
Fly 299 RKHTGERPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAY 363
Fly 364 RCELCDKSFMLPTHLSTH 381 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| M1BP | NP_649825.1 | zf-AD | 13..84 | CDD:214871 | |
| C2H2 Zn finger | 253..273 | CDD:275368 | 5/19 (26%) | ||
| COG5048 | 276..>331 | CDD:227381 | 17/54 (31%) | ||
| C2H2 Zn finger | 281..301 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 293..317 | CDD:290200 | 10/23 (43%) | ||
| C2H2 Zn finger | 309..329 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 324..346 | CDD:290200 | 8/21 (38%) | ||
| C2H2 Zn finger | 337..357 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 350..372 | CDD:290200 | 9/21 (43%) | ||
| C2H2 Zn finger | 365..383 | CDD:275368 | 6/17 (35%) | ||
| M03D4.4 | NP_001023313.1 | C2H2 Zn finger | 90..110 | CDD:275368 | 5/19 (26%) |
| zf-H2C2_2 | 102..127 | CDD:290200 | 7/24 (29%) | ||
| C2H2 Zn finger | 118..138 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 146..166 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 158..181 | CDD:290200 | 7/22 (32%) | ||
| zf-C2H2 | 172..194 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 174..194 | CDD:275368 | 7/19 (37%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||