DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and blmp-1

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001251370.1 Gene:blmp-1 / 172917 WormBaseID:WBGene00003847 Length:817 Species:Caenorhabditis elegans


Alignment Length:161 Identity:54/161 - (33%)
Similarity:83/161 - (51%) Gaps:3/161 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 YICEQCGNHIKGRMA-FELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGR 314
            |.|:.| |...|::: .::|.|.|.|::.|.||:|...|...:.|::|...||||||..|..|.:
 Worm   508 YACKDC-NKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDK 571

  Fly   315 CFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLS 379
            .|:..:....|.|.|..::||.|..|...||....|:.|..:|:.||.|.|..|.|.::.|:.|.
 Worm   572 RFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLR 636

  Fly   380 THFRSGVHKRHLEKAEMKQVLEQEQKRELKE 410
            ||:::...|....|..|:..| .:.|.|:.|
 Worm   637 THWKTTTCKEEDMKDSMRDDL-MDIKGEIDE 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871
C2H2 Zn finger 253..273 CDD:275368 6/20 (30%)
COG5048 276..>331 CDD:227381 19/54 (35%)
C2H2 Zn finger 281..301 CDD:275368 6/19 (32%)
zf-H2C2_2 293..317 CDD:290200 10/23 (43%)
C2H2 Zn finger 309..329 CDD:275368 5/19 (26%)
zf-H2C2_2 324..346 CDD:290200 8/21 (38%)
C2H2 Zn finger 337..357 CDD:275368 6/19 (32%)
zf-H2C2_2 350..372 CDD:290200 9/21 (43%)
C2H2 Zn finger 365..383 CDD:275368 7/17 (41%)
blmp-1NP_001251370.1 SET 119..247 CDD:214614
zf-C2H2 508..530 CDD:278523 7/22 (32%)
C2H2 Zn finger 510..530 CDD:275368 6/20 (30%)
zf-H2C2_2 522..547 CDD:290200 9/24 (38%)
C2H2 Zn finger 538..558 CDD:275368 6/19 (32%)
zf-H2C2_2 550..575 CDD:290200 11/24 (46%)
C2H2 Zn finger 566..586 CDD:275368 5/19 (26%)
zf-H2C2_2 578..603 CDD:290200 8/24 (33%)
C2H2 Zn finger 594..614 CDD:275368 6/19 (32%)
zf-H2C2_2 606..631 CDD:290200 9/24 (38%)
ARS2 <620..772 CDD:282772 15/48 (31%)
C2H2 Zn finger 622..641 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.