DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment M1BP and Zfp369

DIOPT Version :9

Sequence 1:	NP_649825.1	Gene:	M1BP / 41042	FlyBaseID:	FBgn0037621	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_848141.3	Gene:	Zfp369 / 170936	MGIID:	2176229	Length:	845	Species:	Mus musculus

Alignment Length:	141	Identity:	55/141 - (39%)
Similarity:	80/141 - (56%)	Gaps:	2/141 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   253 CEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGRCFT 317
            |.:||...:....|.:|.:.|.|::.:.|..|...|..:|.|.:|:|.|:|||||.|..|||.|:
Mouse   703 CSECGKMFRNARYFSVHKKIHTGERPYMCMSCGKAFVQSSSLTQHLRIHSGERPFECSECGRTFS 767

  Fly   318 DYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLSTHF 382
            |.:...:|.||||..:||.|..|||||.....|..|:.||:|||.|.|..|.|:|...::|..|.
Mouse   768 DRSAASQHLRTHTGAKPYQCQHCGKAFRQSSHLTRHVRIHTGERPYVCTKCGKAFTQSSNLIGHQ 832

  Fly   383 RSGVHKRHLEK 393
            ::  |::..:|
Mouse   833 KT--HRKKFKK 841

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
M1BP	NP_649825.1	zf-AD	13..84	CDD:214871
		C2H2 Zn finger	253..273	CDD:275368	5/19 (26%)
		COG5048	276..>331	CDD:227381	23/54 (43%)
		C2H2 Zn finger	281..301	CDD:275368	7/19 (37%)
		zf-H2C2_2	293..317	CDD:290200	13/23 (57%)
		C2H2 Zn finger	309..329	CDD:275368	8/19 (42%)
		zf-H2C2_2	324..346	CDD:290200	13/21 (62%)
		C2H2 Zn finger	337..357	CDD:275368	8/19 (42%)
		zf-H2C2_2	350..372	CDD:290200	11/21 (52%)
		C2H2 Zn finger	365..383	CDD:275368	6/17 (35%)
Zfp369	NP_848141.3	KRAB	35..94	CDD:214630
		KRAB	35..74	CDD:279668
		SCAN	179..266	CDD:280241
		KRAB	300..>340	CDD:214630
		KRAB	300..339	CDD:279668
		C2H2 Zn finger	676..695	CDD:275370
		C2H2 Zn finger	703..723	CDD:275368	5/19 (26%)
		zf-H2C2_2	715..740	CDD:290200	7/24 (29%)
		COG5048	727..>792	CDD:227381	28/64 (44%)
		C2H2 Zn finger	731..751	CDD:275368	7/19 (37%)
		zf-H2C2_2	743..767	CDD:290200	13/23 (57%)
		zf-C2H2	757..779	CDD:278523	9/21 (43%)
		C2H2 Zn finger	759..779	CDD:275368	8/19 (42%)
		zf-C2H2	785..807	CDD:278523	9/21 (43%)
		C2H2 Zn finger	787..807	CDD:275368	8/19 (42%)
		zf-H2C2_2	799..824	CDD:290200	12/24 (50%)
		C2H2 Zn finger	815..835	CDD:275368	6/21 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000