DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and ZNF784

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_976308.1 Gene:ZNF784 / 147808 HGNCID:33111 Length:323 Species:Homo sapiens


Alignment Length:174 Identity:54/174 - (31%)
Similarity:74/174 - (42%) Gaps:39/174 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 CEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGE------------- 304
            |..||:...|..:...|...|.|::.:.|.||...|...:.|.||..:|..|             
Human   103 CHVCGHSCPGPASLRAHYSLHTGERPYRCALCPRAFKALAPLLRHQHRHGVEPGTSRRPPDTAAV 167

  Fly   305 --------------------------RPFACKYCGRCFTDYTTRVKHERTHTNERPYVCGTCGKA 343
                                      :||||::|.:.|...:....|||.||.||||.||.|||.
Human   168 AEQRPGVAPERAEVVMAAAAAGAAVGKPFACRFCAKPFRRSSDMRDHERVHTGERPYHCGICGKG 232

  Fly   344 FTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLSTHFRSGVH 387
            ||...:|..|..||:|||.:||.|||::|...::...|.|:..|
Human   233 FTQSSVLSGHARIHTGERPFRCTLCDRTFNNSSNFRKHQRTHFH 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871
C2H2 Zn finger 253..273 CDD:275368 5/19 (26%)
COG5048 276..>331 CDD:227381 19/93 (20%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 293..317 CDD:290200 10/62 (16%)
C2H2 Zn finger 309..329 CDD:275368 6/19 (32%)
zf-H2C2_2 324..346 CDD:290200 15/21 (71%)
C2H2 Zn finger 337..357 CDD:275368 9/19 (47%)
zf-H2C2_2 350..372 CDD:290200 12/21 (57%)
C2H2 Zn finger 365..383 CDD:275368 6/17 (35%)
ZNF784NP_976308.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
C2H2 Zn finger 67..87 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 5/19 (26%)
C2H2 Zn finger 131..151 CDD:275368 7/19 (37%)
COG5048 <194..276 CDD:227381 37/81 (46%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
C2H2 Zn finger 226..246 CDD:275368 9/19 (47%)
C2H2 Zn finger 254..274 CDD:275368 7/19 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..323 3/8 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4797
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.