DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment M1BP and ZNF480

DIOPT Version :9

Sequence 1:	NP_649825.1	Gene:	M1BP / 41042	FlyBaseID:	FBgn0037621	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_653285.2	Gene:	ZNF480 / 147657	HGNCID:	23305	Length:	535	Species:	Homo sapiens

Alignment Length:	131	Identity:	55/131 - (41%)
Similarity:	68/131 - (51%)	Gaps:	0/131 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   251 YICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGRC 315
            |.|.:||...........|.|.|.|:|.:.|..|...|...|.|.||.|.||||:|:.|..||:.
Human   371 YKCNECGKVFIQNSHLAQHWRIHTGEKPYKCNECGKVFNQLSNLARHRRIHTGEKPYKCNECGKA 435

  Fly   316 FTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLST 380
            |::|:....|...||.|:||.|..|||||.....|.||..||:|||.|:|..|.|.|....||:.
Human   436 FSEYSGLSAHLVIHTGEKPYKCSECGKAFRHKLSLTNHQRIHTGERPYKCNECGKVFNRIAHLAR 500

  Fly   381 H 381
            |
Human   501 H 501

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
M1BP	NP_649825.1	zf-AD	13..84	CDD:214871
		C2H2 Zn finger	253..273	CDD:275368	5/19 (26%)
		COG5048	276..>331	CDD:227381	21/54 (39%)
		C2H2 Zn finger	281..301	CDD:275368	8/19 (42%)
		zf-H2C2_2	293..317	CDD:290200	12/23 (52%)
		C2H2 Zn finger	309..329	CDD:275368	6/19 (32%)
		zf-H2C2_2	324..346	CDD:290200	12/21 (57%)
		C2H2 Zn finger	337..357	CDD:275368	9/19 (47%)
		zf-H2C2_2	350..372	CDD:290200	12/21 (57%)
		C2H2 Zn finger	365..383	CDD:275368	7/17 (41%)
ZNF480	NP_653285.2	KRAB	27..87	CDD:214630
		KRAB	27..66	CDD:279668
		COG5048	<158..501	CDD:227381	54/129 (42%)
		C2H2 Zn finger	205..225	CDD:275368
		zf-H2C2_2	217..242	CDD:290200
		C2H2 Zn finger	233..253	CDD:275368
		zf-H2C2_2	245..270	CDD:290200
		C2H2 Zn finger	261..281	CDD:275368
		zf-H2C2_2	273..298	CDD:290200
		C2H2 Zn finger	289..309	CDD:275368
		zf-H2C2_2	301..326	CDD:290200
		C2H2 Zn finger	317..336	CDD:275368
		C2H2 Zn finger	345..365	CDD:275368
		zf-H2C2_2	358..382	CDD:290200	4/10 (40%)
		C2H2 Zn finger	373..393	CDD:275368	5/19 (26%)
		zf-H2C2_2	385..410	CDD:290200	8/24 (33%)
		zf-C2H2	399..421	CDD:278523	8/21 (38%)
		C2H2 Zn finger	401..421	CDD:275368	8/19 (42%)
		zf-H2C2_2	413..437	CDD:290200	12/23 (52%)
		C2H2 Zn finger	429..449	CDD:275368	6/19 (32%)
		zf-H2C2_2	442..466	CDD:290200	12/23 (52%)
		C2H2 Zn finger	457..477	CDD:275368	9/19 (47%)
		zf-H2C2_2	469..494	CDD:290200	13/24 (54%)
		COG5048	481..>529	CDD:227381	9/21 (43%)
		C2H2 Zn finger	485..505	CDD:275368	7/17 (41%)
		zf-H2C2_2	497..522	CDD:290200	3/5 (60%)
		C2H2 Zn finger	513..533	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910