DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment M1BP and ZNF816

DIOPT Version :9

Sequence 1:NP_649825.1 Gene:M1BP / 41042 FlyBaseID:FBgn0037621 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001026835.1 Gene:ZNF816 / 125893 HGNCID:26995 Length:651 Species:Homo sapiens


Alignment Length:137 Identity:55/137 - (40%)
Similarity:75/137 - (54%) Gaps:2/137 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 YICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGRC 315
            |.||:|.|....|...|.|.:.|.|:..:.|::|...|.:.|.|..|.|.||||:|:.|..|||.
Human   397 YKCEECDNVYIRRSHLERHRKIHTGEGSYKCKVCDKVFRSDSYLAEHQRVHTGEKPYKCNKCGRS 461

  Fly   316 FTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLST 380
            |:..::...|...||.|:||.|..|||.|:....|..|..:|:||:.|:||.|||.|...:||..
Human   462 FSRKSSLQYHHTLHTGEKPYTCNECGKVFSRRENLARHHRLHAGEKPYKCEECDKVFSRRSHLER 526

  Fly   381 HFRSGVH 387
            |.|  :|
Human   527 HRR--IH 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
M1BPNP_649825.1 zf-AD 13..84 CDD:214871
C2H2 Zn finger 253..273 CDD:275368 7/19 (37%)
COG5048 276..>331 CDD:227381 19/54 (35%)
C2H2 Zn finger 281..301 CDD:275368 7/19 (37%)
zf-H2C2_2 293..317 CDD:290200 12/23 (52%)
C2H2 Zn finger 309..329 CDD:275368 6/19 (32%)
zf-H2C2_2 324..346 CDD:290200 11/21 (52%)
C2H2 Zn finger 337..357 CDD:275368 7/19 (37%)
zf-H2C2_2 350..372 CDD:290200 11/21 (52%)
C2H2 Zn finger 365..383 CDD:275368 9/17 (53%)
ZNF816NP_001026835.1 KRAB 24..64 CDD:307490
C2H2 Zn finger 232..251 CDD:275368
C2H2 Zn finger 259..279 CDD:275368
COG5048 283..650 CDD:227381 55/137 (40%)
C2H2 Zn finger 287..307 CDD:275368
C2H2 Zn finger 315..335 CDD:275368
C2H2 Zn finger 343..363 CDD:275368
C2H2 Zn finger 371..391 CDD:275368
C2H2 Zn finger 399..419 CDD:275368 7/19 (37%)
C2H2 Zn finger 427..447 CDD:275368 7/19 (37%)
C2H2 Zn finger 455..475 CDD:275368 6/19 (32%)
C2H2 Zn finger 483..503 CDD:275368 7/19 (37%)
C2H2 Zn finger 511..531 CDD:275368 10/21 (48%)
C2H2 Zn finger 539..559 CDD:275368
C2H2 Zn finger 567..587 CDD:275368
C2H2 Zn finger 595..615 CDD:275368
C2H2 Zn finger 623..643 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.