DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment M1BP and ERV3-1-ZNF117

DIOPT Version :9

Sequence 1:	NP_649825.1	Gene:	M1BP / 41042	FlyBaseID:	FBgn0037621	Length:	418	Species:	Drosophila melanogaster
Sequence 2:	NP_001334979.1	Gene:	ERV3-1-ZNF117 / 109504726	-ID:	-	Length:	483	Species:	Homo sapiens

Alignment Length:	131	Identity:	52/131 - (39%)
Similarity:	70/131 - (53%)	Gaps:	0/131 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   250 VYICEQCGNHIKGRMAFELHCRRHRGDKQFGCELCQSRFCTTSELKRHMRKHTGERPFACKYCGR 314
            :|.||:||...........|.|.|.|:|.:.||.|...|...|.|..|.:.||||:|:.|:.||:
Human   276 LYKCEECGKAFNQSSTLTTHKRIHSGEKPYKCEECGKAFKQFSNLTDHKKIHTGEKPYKCEECGK 340

  Fly   315 CFTDYTTRVKHERTHTNERPYVCGTCGKAFTTGYILKNHMLIHSGERAYRCELCDKSFMLPTHLS 379
            .|...:...:|:..||.|:||.||.|||||.....|..|.:||:||..::|....|.|.|.:.||
Human   341 AFNQLSNLTRHKVIHTGEKPYKCGECGKAFNQSSALNTHKIIHTGENPHKCRESGKVFHLSSKLS 405

  Fly   380 T 380
            |
Human   406 T 406

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
M1BP	NP_649825.1	zf-AD	13..84	CDD:214871
		C2H2 Zn finger	253..273	CDD:275368	6/19 (32%)
		COG5048	276..>331	CDD:227381	19/54 (35%)
		C2H2 Zn finger	281..301	CDD:275368	7/19 (37%)
		zf-H2C2_2	293..317	CDD:290200	10/23 (43%)
		C2H2 Zn finger	309..329	CDD:275368	5/19 (26%)
		zf-H2C2_2	324..346	CDD:290200	13/21 (62%)
		C2H2 Zn finger	337..357	CDD:275368	9/19 (47%)
		zf-H2C2_2	350..372	CDD:290200	8/21 (38%)
		C2H2 Zn finger	365..383	CDD:275368	7/16 (44%)
ERV3-1-ZNF117	NP_001334979.1	C2H2 Zn finger	111..131	CDD:275368
		C2H2 Zn finger	139..159	CDD:275368
		COG5048	163..>475	CDD:227381	52/131 (40%)
		C2H2 Zn finger	167..187	CDD:275368
		C2H2 Zn finger	195..215	CDD:275368
		C2H2 Zn finger	223..243	CDD:275368
		C2H2 Zn finger	251..271	CDD:275368
		C2H2 Zn finger	279..299	CDD:275368	6/19 (32%)
		C2H2 Zn finger	307..327	CDD:275368	7/19 (37%)
		C2H2 Zn finger	335..355	CDD:275368	5/19 (26%)
		C2H2 Zn finger	363..383	CDD:275368	9/19 (47%)
		C2H2 Zn finger	391..407	CDD:275368	7/16 (44%)
		C2H2 Zn finger	419..439	CDD:275368
		C2H2 Zn finger	447..467	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000