DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ranshi and ZNF561

DIOPT Version :9

Sequence 1:	NP_649824.1	Gene:	ranshi / 41041	FlyBaseID:	FBgn0037620	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	XP_024307548.1	Gene:	ZNF561 / 93134	HGNCID:	28684	Length:	502	Species:	Homo sapiens

Alignment Length:	137	Identity:	54/137 - (39%)
Similarity:	77/137 - (56%)	Gaps:	4/137 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly   194 RTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCS 258
            ::|.|:|||...::......|.:.|.|:|...|.:|...|....:|..|:|.|||.||::|:.|.
Human   295 KSFECKECGRSFRNSSCLNDHIQIHTGIKPHKCTYCGKAFTRSTQLTEHVRTHTGIKPYECKECG 359

  Fly   259 RSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLF----SR 319
            ::|:.||....|.|:|:.::|:.||||..|||||..|..|..:|||||.:.|..|.|.|    .|
Human   360 QAFAQYSGLSIHIRSHSGKKPYQCKECGKAFTTSTSLIQHTRIHTGEKPYECVECGKTFITSSRR 424

  Fly   320 YTHLTTH 326
            ..||.||
Human   425 SKHLKTH 431

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ranshi	NP_649824.1	zf-AD	5..77	CDD:214871
		C2H2 Zn finger	198..218	CDD:275368	5/19 (26%)
		COG5048	222..>276	CDD:227381	20/53 (38%)
		C2H2 Zn finger	226..246	CDD:275368	6/19 (32%)
		zf-H2C2_2	238..262	CDD:290200	10/23 (43%)
		C2H2 Zn finger	254..274	CDD:275368	7/19 (37%)
		zf-H2C2_2	269..291	CDD:290200	10/21 (48%)
		C2H2 Zn finger	282..302	CDD:275368	11/19 (58%)
		zf-H2C2_2	295..319	CDD:290200	11/27 (41%)
		C2H2 Zn finger	310..328	CDD:275368	9/21 (43%)
ZNF561	XP_024307548.1	KRAB	56..96	CDD:307490
		C2H2 Zn finger	190..207	CDD:275370
		C2H2 Zn finger	215..235	CDD:275368
		C2H2 Zn finger	243..263	CDD:275368
		COG5048	<287..483	CDD:227381	54/137 (39%)
		C2H2 Zn finger	299..319	CDD:275368	5/19 (26%)
		C2H2 Zn finger	327..347	CDD:275368	6/19 (32%)
		C2H2 Zn finger	355..375	CDD:275368	7/19 (37%)
		C2H2 Zn finger	383..403	CDD:275368	11/19 (58%)
		C2H2 Zn finger	411..431	CDD:275368	7/19 (37%)
		C2H2 Zn finger	439..459	CDD:275368
		C2H2 Zn finger	467..487	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910