DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CRZ1

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_014371.1 Gene:CRZ1 / 855704 SGDID:S000004972 Length:678 Species:Saccharomyces cerevisiae


Alignment Length:273 Identity:66/273 - (24%)
Similarity:106/273 - (38%) Gaps:73/273 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ESPKSVLEQEELELDLAEISIEVERLDDLNEGPIQSSGFKVEDILNESKINEDEPNN-------- 147
            |..||:....|..|::|::....|  :|.|.....:......:.:|.|..|||..||        
Yeast   432 EKAKSISANREKLLEMADLLPSSE--NDNNRERYDNDSKTSYNTINSSNFNEDNNNNNLLTSKPK 494

  Fly   148 --------EDDIDYSEMDY-LIYESDT--EVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCEEC 201
                    ::::|.:..|. ::.:.|:  :.:.|...|:|.       |..|  :.|.||..::.
Yeast   495 IESGIVNIKNELDDTSKDLGILLDIDSLGQFEQKVGFKNDD-------NHEN--NDNGTFSVKKN 550

  Fly   202 GNHIK-DRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYS 265
            .|..| |.::     ...:....|.|:.|..:|..|..||.|:                      
Yeast   551 DNLEKLDSVT-----NNRKNPANFACDVCGKKFTRPYNLKSHL---------------------- 588

  Fly   266 TRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCD---------LCDKLFSRYT 321
                  |||||||||:|..|..||...:..|.|..:|||:|.:.|.         .|.|.|:|..
Yeast   589 ------RTHTNERPFICSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCGKKFARSD 647

  Fly   322 HLTTHYRSNAHRR 334
            .|..|:::.:.||
Yeast   648 ALGRHFKTESGRR 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 3/20 (15%)
COG5048 222..>276 CDD:227381 11/53 (21%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 3/23 (13%)
C2H2 Zn finger 254..274 CDD:275368 1/19 (5%)
zf-H2C2_2 269..291 CDD:290200 13/21 (62%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 10/32 (31%)
C2H2 Zn finger 310..328 CDD:275368 7/26 (27%)
CRZ1NP_014371.1 COG5048 139..617 CDD:227381 53/228 (23%)
C2H2 Zn finger 571..591 CDD:275368 8/47 (17%)
C2H2 Zn finger 599..619 CDD:275368 6/19 (32%)
C2H2 Zn finger 627..655 CDD:275368 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.