DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZAP1

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_012479.1 Gene:ZAP1 / 853390 SGDID:S000003592 Length:880 Species:Saccharomyces cerevisiae


Alignment Length:155 Identity:51/155 - (32%)
Similarity:82/155 - (52%) Gaps:10/155 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 NRTF-FCEECGNHIKDRISFILHCKRHRGVKEFGCEF--CEDRFCTPAELKRHIRKHTGEKPFKC 254
            |::| ..:|..:|::     .:|..  ||..|:.|.:  |...|....:|.||::.|:..||:||
Yeast   713 NKSFSSAQELNDHLE-----AVHLT--RGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKC 770

  Fly   255 RHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSR 319
            :.|.|.||...|.::|.|||:.|:|:.|..||..|..|..||.|:..|||||..:|.:|.|.|:.
Yeast   771 KTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNE 835

  Fly   320 YTHLTTHYRSNAHRRNMQKADTIFD 344
            .::|:.|.:::..:.........||
Yeast   836 SSNLSKHIKTHQKKYKCSDCSKSFD 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 3/19 (16%)
COG5048 222..>276 CDD:227381 21/55 (38%)
C2H2 Zn finger 226..246 CDD:275368 6/21 (29%)
zf-H2C2_2 238..262 CDD:290200 10/23 (43%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 10/21 (48%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 6/17 (35%)
ZAP1NP_012479.1 COG5048 292..761 CDD:227381 14/54 (26%)
C2H2 Zn finger 743..762 CDD:275368 5/18 (28%)
SUF4-like 766..>814 CDD:411020 22/47 (47%)
C2H2 Zn finger 770..795 CDD:411020 11/24 (46%)
C2H2 Zn finger 770..790 CDD:275368 8/19 (42%)
C2H2 Zn finger 798..818 CDD:275368 8/19 (42%)
zf-H2C2_2 810..834 CDD:404364 11/23 (48%)
C2H2 Zn finger 826..846 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.