DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ranshi and ZNF341

DIOPT Version :9

Sequence 1:	NP_649824.1	Gene:	ranshi / 41041	FlyBaseID:	FBgn0037620	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	NP_001269862.1	Gene:	ZNF341 / 84905	HGNCID:	15992	Length:	854	Species:	Homo sapiens

Alignment Length:	185	Identity:	50/185 - (27%)
Similarity:	69/185 - (37%)	Gaps:	41/185 - (22%)

- Green bases have known domain annotations that are detailed below.

  Fly   186 RRNPRDSNRTFFCEECGNHIK--DRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTG 248
            :.:|:..|..:.|.:|.|...  :.:...|....|    .|.|..|:..|.....|:||:..|..
Human   530 QHSPKKDNAVYKCVKCVNKYSTPEALEHHLQTATH----NFPCPHCQKVFPCERYLRRHLPTHGS 590

  Fly   249 EKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLV------------ 301
            ...|||:.|.:.|........|...|:.|:|:.|..|.:||.....||.|||:
Human   591 GGRFKCQVCKKFFRREHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFS 655

  Fly   302 ---------------------HTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRRN 335
                                 |:|.|..:|.||.|.|||..||..|.|  ||..|
Human   656 THTGCSKEFNRPDKLKAHILSHSGMKLHKCALCSKSFSRRAHLAEHQR--AHTGN 708

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ranshi	NP_649824.1	zf-AD	5..77	CDD:214871
		C2H2 Zn finger	198..218	CDD:275368	4/21 (19%)
		COG5048	222..>276	CDD:227381	15/53 (28%)
		C2H2 Zn finger	226..246	CDD:275368	6/19 (32%)
		zf-H2C2_2	238..262	CDD:290200	8/23 (35%)
		C2H2 Zn finger	254..274	CDD:275368	4/19 (21%)
		zf-H2C2_2	269..291	CDD:290200	8/21 (38%)
		C2H2 Zn finger	282..302	CDD:275368	9/52 (17%)
		zf-H2C2_2	295..319	CDD:290200	13/56 (23%)
		C2H2 Zn finger	310..328	CDD:275368	10/17 (59%)
ZNF341	NP_001269862.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	152..217
		COG5048	323..729	CDD:227381	50/185 (27%)
		C2H2 Zn finger	324..344	CDD:275368
		C2H2 Zn finger	352..372	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	399..434
		C2H2 Zn finger	447..467	CDD:275368
		C2H2 Zn finger	475..497	CDD:275368
		C2H2 Zn finger	505..525	CDD:275368
		C2H2 Zn finger	542..562	CDD:275370	4/19 (21%)
		C2H2 Zn finger	568..588	CDD:275368	6/19 (32%)
		C2H2 Zn finger	596..616	CDD:275368	4/19 (21%)
		C2H2 Zn finger	624..644	CDD:275368	9/19 (47%)
		C2H2 Zn finger	652..677	CDD:275368	0/24 (0%)
		C2H2 Zn finger	685..705	CDD:275368	11/21 (52%)
		C2H2 Zn finger	713..730	CDD:275368
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	731..763
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165146332
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930