DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment ranshi and ZNF577

DIOPT Version :9

Sequence 1:	NP_649824.1	Gene:	ranshi / 41041	FlyBaseID:	FBgn0037620	Length:	346	Species:	Drosophila melanogaster
Sequence 2:	NP_001357376.1	Gene:	ZNF577 / 84765	HGNCID:	28673	Length:	485	Species:	Homo sapiens

Alignment Length:	131	Identity:	53/131 - (40%)
Similarity:	69/131 - (52%)	Gaps:	0/131 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   198 CEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFS 262
            |..||.....:...|.|.:..||.|..||..|...|....:|..|.|.||||||.:|..|.::||
Human   160 CSVCGRAFSRKAQLIQHQRTERGEKPHGCGECGKTFMRKIQLTEHQRTHTGEKPHECSECGKAFS 224

  Fly   263 DYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHY 327
            ..|..:.|:||||.|:|:.|.:|..||:....|..|...|||||.:.|.:|.|.||:..:||.|.
Human   225 RKSQLMVHQRTHTGEKPYRCSKCGKAFSRKCRLNRHQRSHTGEKLYGCSVCGKAFSQKAYLTAHQ 289

  Fly   328 R 328
            |
Human   290 R 290

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
ranshi	NP_649824.1	zf-AD	5..77	CDD:214871
		C2H2 Zn finger	198..218	CDD:275368	5/19 (26%)
		COG5048	222..>276	CDD:227381	23/53 (43%)
		C2H2 Zn finger	226..246	CDD:275368	6/19 (32%)
		zf-H2C2_2	238..262	CDD:290200	11/23 (48%)
		C2H2 Zn finger	254..274	CDD:275368	7/19 (37%)
		zf-H2C2_2	269..291	CDD:290200	11/21 (52%)
		C2H2 Zn finger	282..302	CDD:275368	6/19 (32%)
		zf-H2C2_2	295..319	CDD:290200	11/23 (48%)
		C2H2 Zn finger	310..328	CDD:275368	8/17 (47%)
ZNF577	NP_001357376.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..21
		KRAB	25..83	CDD:214630
		COG5048	136..>217	CDD:227381	21/56 (38%)
		C2H2 Zn finger	160..180	CDD:275368	5/19 (26%)
		C2H2 Zn finger	188..208	CDD:275368	6/19 (32%)
		COG5048	<194..399	CDD:227381	42/97 (43%)
		C2H2 Zn finger	216..236	CDD:275368	7/19 (37%)
		C2H2 Zn finger	244..264	CDD:275368	6/19 (32%)
		C2H2 Zn finger	272..292	CDD:275368	9/19 (47%)
		C2H2 Zn finger	300..320	CDD:275368
		C2H2 Zn finger	328..348	CDD:275368
		C2H2 Zn finger	356..376	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910