Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_172306.1 | Gene: | WIP3 / 837349 | AraportID: | AT1G08290 | Length: | 337 | Species: | Arabidopsis thaliana |
Alignment Length: | 252 | Identity: | 50/252 - (19%) |
---|---|---|---|
Similarity: | 85/252 - (33%) | Gaps: | 79/252 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 136 NESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCEE 200
Fly 201 CGNHIKDRISFILHCKRHRGVK------EFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSR 259
Fly 260 SFSDYSTRLKHERTHTNE------------RP--------FVCKE-CNN-----------AFTTS 292
Fly 293 YILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNA------------HRRNMQ 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
C2H2 Zn finger | 198..218 | CDD:275368 | 3/19 (16%) | ||
COG5048 | 222..>276 | CDD:227381 | 16/59 (27%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 238..262 | CDD:290200 | 6/23 (26%) | ||
C2H2 Zn finger | 254..274 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 269..291 | CDD:290200 | 9/53 (17%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 8/31 (26%) | ||
zf-H2C2_2 | 295..319 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 310..328 | CDD:275368 | 5/17 (29%) | ||
WIP3 | NP_172306.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 62 | 1.000 | Inparanoid score | I2531 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_120097 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.950 |