DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and WIP3

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_172306.1 Gene:WIP3 / 837349 AraportID:AT1G08290 Length:337 Species:Arabidopsis thaliana


Alignment Length:252 Identity:50/252 - (19%)
Similarity:85/252 - (33%) Gaps:79/252 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 NESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCEE 200
            |.|:.::.:..|:||:...::.:..|...:..|.........:.|.||                 
plant    84 NNSQASDIKEENKDDVVTLQIGFPKYHRGSSEDGSDITFDHQKKPIKR----------------- 131

  Fly   201 CGNHIKDRISFILHCKRHRGVK------EFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSR 259
              ..|:|.:..:   |:.|.:|      :...|.|..||..|:..:.|:    |...|.|..||:
plant   132 --EIIEDGVVMM---KKRRKMKFDEEIIDSDVEVCGKRFWIPSPAQIHV----GPMQFACSICSK 187

  Fly   260 SFSDYSTRLKHERTHTNE------------RP--------FVCKE-CNN-----------AFTTS 292
            :|:.|:....|...|.:|            :|        :.|.| |.|           .|.| 
plant   188 TFNRYNNMQMHMWGHGSEFRKGADSLKGTIQPAAILRLPCYCCAEGCKNNINHPRSKPLKDFRT- 251

  Fly   293 YILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNA------------HRRNMQ 337
              |:.|.....|.|.|.|..|.|..:......||.::..            |:|:::
plant   252 --LQTHYKRKHGSKPFSCGKCGKALAVKGDWRTHEKNCGKLWYCTCGSDFKHKRSLK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 3/19 (16%)
COG5048 222..>276 CDD:227381 16/59 (27%)
C2H2 Zn finger 226..246 CDD:275368 6/19 (32%)
zf-H2C2_2 238..262 CDD:290200 6/23 (26%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 9/53 (17%)
C2H2 Zn finger 282..302 CDD:275368 8/31 (26%)
zf-H2C2_2 295..319 CDD:290200 8/23 (35%)
C2H2 Zn finger 310..328 CDD:275368 5/17 (29%)
WIP3NP_172306.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.950

Return to query results.
Submit another query.