| Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_849323.1 | Gene: | YY1 / 826093 | AraportID: | AT4G06634 | Length: | 387 | Species: | Arabidopsis thaliana |
| Alignment Length: | 255 | Identity: | 58/255 - (22%) |
|---|---|---|---|
| Similarity: | 93/255 - (36%) | Gaps: | 84/255 - (32%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 132 EDILNESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRTF 196
Fly 197 FC--EECGNHIKDRISFILHCKRHRGVKEFGC--EFCEDRFCTPAELKRHIRKHTGEKPFKCRH- 256
Fly 257 -CSRSFS-DYSTRLKHERTHTNERPFVC--KECNNAFTTSYILKNHMLVH--------------- 302
Fly 303 -----------------TGEKAFRC--DLCDKLFSRYTHLTTHYRSNAHRRNMQK--ADT 341 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
| C2H2 Zn finger | 198..218 | CDD:275368 | 5/21 (24%) | ||
| COG5048 | 222..>276 | CDD:227381 | 21/58 (36%) | ||
| C2H2 Zn finger | 226..246 | CDD:275368 | 8/21 (38%) | ||
| zf-H2C2_2 | 238..262 | CDD:290200 | 10/25 (40%) | ||
| C2H2 Zn finger | 254..274 | CDD:275368 | 7/22 (32%) | ||
| zf-H2C2_2 | 269..291 | CDD:290200 | 6/23 (26%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 295..319 | CDD:290200 | 7/57 (12%) | ||
| C2H2 Zn finger | 310..328 | CDD:275368 | 5/19 (26%) | ||
| YY1 | NP_849323.1 | C2H2 Zn finger | 84..103 | CDD:275368 | 4/18 (22%) |
| COG5048 | <92..170 | CDD:227381 | 26/79 (33%) | ||
| C2H2 Zn finger | 110..132 | CDD:275368 | 8/21 (38%) | ||
| C2H2 Zn finger | 140..162 | CDD:275368 | 7/22 (32%) | ||
| C2H2 Zn finger | 170..189 | CDD:275368 | 6/18 (33%) | ||
| SFP1 | <196..274 | CDD:227516 | 10/72 (14%) | ||
| C2H2 Zn finger | 232..252 | CDD:275368 | 5/19 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||