DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZNF552

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_079038.2 Gene:ZNF552 / 79818 HGNCID:26135 Length:407 Species:Homo sapiens


Alignment Length:361 Identity:95/361 - (26%)
Similarity:146/361 - (40%) Gaps:81/361 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCG------------KRTNAERSLN--------IFEKRN--QTTLEHI--KLLTGAVLKNCST 46
            |..||            :.|:.::.|:        :::..|  |...|||  |...|:|      
Human    93 CEMCGPILGDILHVADHQGTHHKQKLHRCEAWGNKLYDSGNFHQHQNEHIGEKPYRGSV------ 151

  Fly    47 LPNRLCASCQTCLQQAISFRERC-LEVQRE-LLHSQDDEDFLRICQESPKSVLEQEELELDLAEI 109
                         ::|: |.:|| |.|..| .:.|:..:|||     ....:|:||......:..
Human   152 -------------EEAL-FAKRCKLHVSGESSVFSESGKDFL-----LRSGLLQQEATHTGKSNS 197

  Fly   110 SIEVERLDDLNEGPIQSSG----FKVEDIL--NESKINEDEPNNEDDIDYSEMDYLIYESDTEVD 168
            ..|...|....:......|    |..:|||  :|..:..:||:     .:.|.            
Human   198 KTECVSLFHGGKSHYSCGGCMKHFSTKDILSQHERLLPTEEPS-----VWCEC------------ 245

  Fly   169 AKQELKSDSENPKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRF 233
            .|...|.||.:     |.:......:.:.|..||.....:...::|.:.|.|.|.:.||.|:..|
Human   246 GKSSSKYDSFS-----NHQGVHTREKPYTCGICGKLFNSKSHLLVHQRIHTGEKPYECEVCQKFF 305

  Fly   234 CTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNH 298
            .....|..|.|.||||:|::|..|.:||:..||...|:|.||.::|:.|.||..:|..|..|..|
Human   306 RHKYHLIAHQRVHTGERPYECSDCGKSFTHSSTFRVHKRVHTGQKPYECSECGKSFAESSSLTKH 370

  Fly   299 MLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRR 334
            ..||||||.:.|..|:|.|.:.:.|..|.|  .|:|
Human   371 RRVHTGEKPYGCSECEKKFRQISSLRHHQR--VHKR 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 20/96 (21%)
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
COG5048 222..>276 CDD:227381 22/53 (42%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 11/23 (48%)
C2H2 Zn finger 254..274 CDD:275368 8/19 (42%)
zf-H2C2_2 269..291 CDD:290200 9/21 (43%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-H2C2_2 295..319 CDD:290200 12/23 (52%)
C2H2 Zn finger 310..328 CDD:275368 6/17 (35%)
ZNF552NP_079038.2 KRAB 14..>55 CDD:214630
KRAB 14..53 CDD:279668
C2H2 Zn finger 93..113 CDD:275368 3/19 (16%)
C2H2 Zn finger 121..141 CDD:275368 2/19 (11%)
C2H2 Zn finger 214..234 CDD:275368 6/19 (32%)
COG5048 <243..407 CDD:227381 58/181 (32%)
C2H2 Zn finger 244..262 CDD:275368 6/34 (18%)
C2H2 Zn finger 270..290 CDD:275368 4/19 (21%)
zf-H2C2_2 282..307 CDD:290200 8/24 (33%)
C2H2 Zn finger 298..318 CDD:275368 7/19 (37%)
zf-H2C2_2 310..335 CDD:290200 12/24 (50%)
C2H2 Zn finger 326..346 CDD:275368 8/19 (42%)
zf-H2C2_2 339..362 CDD:290200 8/22 (36%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
C2H2 Zn finger 382..402 CDD:275368 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.