DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and si:dkey-262g12.12

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_017211312.1 Gene:si:dkey-262g12.12 / 798048 ZFINID:ZDB-GENE-161017-24 Length:355 Species:Danio rerio


Alignment Length:241 Identity:71/241 - (29%)
Similarity:108/241 - (44%) Gaps:44/241 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 QSSGFKVEDILNESKINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSD-------SENPKK 182
            :|...|:||..        ...:||..:.:|:..:..|:....:.:|:.:.|       .|...|
Zfish     7 ESEDLKIEDTF--------VVKHEDPQEQTELMVMKEETQDRNETQQKCQYDKHQDSTLDEKSLK 63

  Fly   183 RRNRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHI---- 243
            ::..|.| ...|.:.|.:|....::|.:..:|.:.|.|.|.|.|:.|..||.....||.|:    
Zfish    64 KKCERIP-TGERMYTCPQCEKSFRERQALEIHIRIHTGEKPFSCDHCGRRFSQKPNLKAHMSIHT 127

  Fly   244 ------------------------RKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKE 284
                                    |.|||||||.|:.|.:.|:..:....|.||||.|:||.|::
Zfish   128 AEKPYSCSECGKSFRAKKQLEGHTRVHTGEKPFACQQCGKRFAYQAAFRTHTRTHTGEKPFTCEQ 192

  Fly   285 CNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSN 330
            |..:||.|..:|.||.||||||.:.|..|.|.|:..|:|..|.|::
Zfish   193 CGKSFTHSEYMKAHMRVHTGEKPYTCSQCGKTFAHRTNLYVHRRTH 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
COG5048 222..>276 CDD:227381 24/81 (30%)
C2H2 Zn finger 226..246 CDD:275368 8/47 (17%)
zf-H2C2_2 238..262 CDD:290200 13/51 (25%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 295..319 CDD:290200 13/23 (57%)
C2H2 Zn finger 310..328 CDD:275368 7/17 (41%)
si:dkey-262g12.12XP_017211312.1 C2H2 Zn finger 78..98 CDD:275368 4/19 (21%)
COG5048 <90..346 CDD:227381 53/149 (36%)
C2H2 Zn finger 106..126 CDD:275368 7/19 (37%)
C2H2 Zn finger 134..154 CDD:275368 1/19 (5%)
C2H2 Zn finger 162..182 CDD:275368 5/19 (26%)
C2H2 Zn finger 190..210 CDD:275368 8/19 (42%)
C2H2 Zn finger 218..238 CDD:275368 8/19 (42%)
C2H2 Zn finger 246..266 CDD:275368
C2H2 Zn finger 274..294 CDD:275368
C2H2 Zn finger 302..322 CDD:275368
C2H2 Zn finger 330..350 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.