Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001104681.1 | Gene: | znf1003 / 793476 | ZFINID: | ZDB-GENE-080219-42 | Length: | 336 | Species: | Danio rerio |
Alignment Length: | 325 | Identity: | 86/325 - (26%) |
---|---|---|---|
Similarity: | 133/325 - (40%) | Gaps: | 64/325 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 82 DEDFLRICQESPKSVLE-QEELELDLAEISIEVERLDDLNEGPIQSSGFKVEDILNESKINEDEP 145
Fly 146 NNEDDIDYSEMDYLIYESDTEV---------DAKQELKSDSENPK--------------KRRNRR 187
Fly 188 NPRDSN----------------RTFF-------------------CEECGNHIKDRISFILHCKR 217
Fly 218 HRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVC 282
Fly 283 KECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRRNMQKAD-TIFDKP 346
Fly 347 346 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
C2H2 Zn finger | 198..218 | CDD:275368 | 6/19 (32%) | ||
COG5048 | 222..>276 | CDD:227381 | 24/53 (45%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 238..262 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 254..274 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 269..291 | CDD:290200 | 10/21 (48%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 295..319 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 310..328 | CDD:275368 | 9/17 (53%) | ||
znf1003 | NP_001104681.1 | COG5048 | <36..269 | CDD:227381 | 56/232 (24%) |
C2H2 Zn finger | 90..110 | CDD:275368 | 2/19 (11%) | ||
zf-H2C2_2 | 102..127 | CDD:290200 | 3/24 (13%) | ||
C2H2 Zn finger | 118..138 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 131..155 | CDD:290200 | 3/23 (13%) | ||
C2H2 Zn finger | 146..166 | CDD:275368 | 3/19 (16%) | ||
zf-H2C2_2 | 158..183 | CDD:290200 | 4/24 (17%) | ||
C2H2 Zn finger | 174..194 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 202..222 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 215..238 | CDD:290200 | 13/22 (59%) | ||
C2H2 Zn finger | 230..250 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 242..267 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 258..278 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 286..306 | CDD:275368 | 9/19 (47%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |