DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and ZBTB17

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001274532.1 Gene:ZBTB17 / 7709 HGNCID:12936 Length:810 Species:Homo sapiens


Alignment Length:262 Identity:76/262 - (29%)
Similarity:116/262 - (44%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ESPKSVLEQEELELDLA----EISIEVERLDDLNEGP--IQSSGFKVEDILNESKINEDEPNNED 149
            |:..|...::|:|::.|    |...|.|..::...||  ::..|.::|        |.:.|...:
Human   211 EAALSESSEQEMEVEPARKGEEEQKEQEEQEEEGAGPAEVKEEGSQLE--------NGEAPEENE 267

  Fly   150 DIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRT---------FFCEECGNHI 205
            :           |.....|:.|||.|::      |..|:....:||         ..||:||...
Human   268 N-----------EESAGTDSGQELGSEA------RGLRSGTYGDRTESKAYGSVIHKCEDCGKEF 315

  Fly   206 KDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKH 270
            ....:|..|.:.|.|.|.|.|..|...|..||..|.|.:.|:..||:.|..|.:|:...|....|
Human   316 THTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYGCEECGKSYRLISLLNLH 380

  Fly   271 ERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLF----SRYTHLTTHYRSNA 331
            ::.|:.|..:.|::|...||||..||.|.|||:|||.::||.|.:.|    |:..||.||.....
Human   381 KKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYCGRSFSDPTSKMRHLETHDTDKE 445

  Fly   332 HR 333
            |:
Human   446 HK 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
COG5048 222..>276 CDD:227381 18/53 (34%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 8/23 (35%)
C2H2 Zn finger 254..274 CDD:275368 5/19 (26%)
zf-H2C2_2 269..291 CDD:290200 6/21 (29%)
C2H2 Zn finger 282..302 CDD:275368 10/19 (53%)
zf-H2C2_2 295..319 CDD:290200 13/27 (48%)
C2H2 Zn finger 310..328 CDD:275368 9/21 (43%)
ZBTB17NP_001274532.1 BTB 14..109 CDD:279045
BTB 25..109 CDD:197585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..295 22/108 (20%)
Interaction with MYC 269..308 10/44 (23%)
COG5048 306..637 CDD:227381 52/142 (37%)
zf-C2H2 306..328 CDD:278523 6/21 (29%)
C2H2 Zn finger 308..328 CDD:275368 6/19 (32%)
zf-H2C2_2 320..344 CDD:290200 8/23 (35%)
C2H2 Zn finger 336..356 CDD:275368 7/19 (37%)
C2H2 Zn finger 364..384 CDD:275368 5/19 (26%)
zf-C2H2 390..412 CDD:278523 10/21 (48%)
C2H2 Zn finger 392..412 CDD:275368 10/19 (53%)
zf-H2C2_2 404..428 CDD:290200 12/23 (52%)
C2H2 Zn finger 420..440 CDD:275368 7/19 (37%)
zf-C2H2 446..468 CDD:278523 1/2 (50%)
C2H2 Zn finger 448..468 CDD:275368 76/262 (29%)
zf-C2H2 475..496 CDD:278523
C2H2 Zn finger 476..496 CDD:275368
zf-H2C2_2 488..512 CDD:290200
C2H2 Zn finger 504..524 CDD:275368
zf-H2C2_2 516..541 CDD:290200
C2H2 Zn finger 532..552 CDD:275368
zf-H2C2_2 544..569 CDD:290200
C2H2 Zn finger 560..580 CDD:275368
zf-H2C2_2 573..597 CDD:290200
C2H2 Zn finger 588..608 CDD:275368
zf-H2C2_2 600..625 CDD:290200
C2H2 Zn finger 616..635 CDD:275370
C2H2 Zn finger 726..746 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 786..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.