| Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_066575.2 | Gene: | ZNF8 / 7554 | HGNCID: | 13154 | Length: | 575 | Species: | Homo sapiens |
| Alignment Length: | 271 | Identity: | 84/271 - (30%) |
|---|---|---|---|
| Similarity: | 124/271 - (45%) | Gaps: | 39/271 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 87 RICQESPKSVLEQEEL-ELDLAEISIEVERLDDLNEGPIQSSGFKVEDILNESKINEDEPNNEDD 150
Fly 151 IDYSEMDYLIYES---DTEVDA---KQELKSDSENPKKRRNRRNPRDS---------------NR 194
Fly 195 TFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSR 259
Fly 260 SFSDYSTRLK-HERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHL 323
Fly 324 TTHYRSNAHRR 334 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
| C2H2 Zn finger | 198..218 | CDD:275368 | 4/19 (21%) | ||
| COG5048 | 222..>276 | CDD:227381 | 22/54 (41%) | ||
| C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 238..262 | CDD:290200 | 12/23 (52%) | ||
| C2H2 Zn finger | 254..274 | CDD:275368 | 9/20 (45%) | ||
| zf-H2C2_2 | 269..291 | CDD:290200 | 10/22 (45%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 295..319 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 310..328 | CDD:275368 | 9/17 (53%) | ||
| ZNF8 | NP_066575.2 | KRAB | 25..85 | CDD:214630 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 92..130 | ||||
| COG5048 | <167..404 | CDD:227381 | 75/234 (32%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 210..237 | 5/28 (18%) | |||
| C2H2 Zn finger | 259..279 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 287..307 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 315..335 | CDD:275368 | 9/20 (45%) | ||
| C2H2 Zn finger | 343..363 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 371..391 | CDD:275368 | 10/19 (53%) | ||
| zf-C2H2 | 397..419 | CDD:306579 | |||
| C2H2 Zn finger | 399..419 | CDD:275368 | |||
| zf-C2H2 | 467..489 | CDD:306579 | |||
| C2H2 Zn finger | 469..489 | CDD:275368 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 488..533 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||