Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598667.2 | Gene: | Zkscan1 / 74570 | MGIID: | 1921820 | Length: | 561 | Species: | Mus musculus |
Alignment Length: | 449 | Identity: | 103/449 - (22%) |
---|---|---|---|
Similarity: | 154/449 - (34%) | Gaps: | 173/449 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 NRLCASCQTCLQQAISFRERCLEVQRELLHSQDDEDFLRICQESPKSVLEQ-------------E 100
Fly 101 ELELDLA--EISIEVERLDDLNEG-----PIQ-SSGF---------------------------- 129
Fly 130 ----------------------------KVED-----ILNE--------SKINED---------- 143
Fly 144 ----EPNN-----------EDDIDYSEMDYLIYESDTEVDAKQE-----LKSDSENPKKRRNR-- 186
Fly 187 -----------------RNPRDSN------------------------RTFFCEECGNHIKDRIS 210
Fly 211 FILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHT 275
Fly 276 NERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRR 334 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | 8/27 (30%) |
C2H2 Zn finger | 198..218 | CDD:275368 | 7/19 (37%) | ||
COG5048 | 222..>276 | CDD:227381 | 21/53 (40%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 238..262 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 254..274 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 269..291 | CDD:290200 | 10/21 (48%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 295..319 | CDD:290200 | 11/23 (48%) | ||
C2H2 Zn finger | 310..328 | CDD:275368 | 7/17 (41%) | ||
Zkscan1 | NP_598667.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..51 | ||
SCAN | 52..162 | CDD:128708 | 23/93 (25%) | ||
SCAN | 52..129 | CDD:280241 | 14/60 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 163..187 | 4/23 (17%) | |||
KRAB | 225..263 | CDD:279668 | 8/37 (22%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 260..372 | 13/114 (11%) | |||
COG5048 | <354..535 | CDD:227381 | 54/160 (34%) | ||
zf-C2H2 | 375..397 | CDD:278523 | 7/21 (33%) | ||
C2H2 Zn finger | 377..397 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 389..413 | CDD:290200 | 8/23 (35%) | ||
C2H2 Zn finger | 405..425 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 417..442 | CDD:290200 | 12/24 (50%) | ||
C2H2 Zn finger | 433..453 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 445..470 | CDD:290200 | 10/24 (42%) | ||
C2H2 Zn finger | 461..481 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 473..498 | CDD:290200 | 11/24 (46%) | ||
C2H2 Zn finger | 489..509 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 501..526 | CDD:290200 | 3/13 (23%) | ||
C2H2 Zn finger | 517..537 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |