DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and znf281

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_002935748.1 Gene:znf281 / 733827 XenbaseID:XB-GENE-5933312 Length:796 Species:Xenopus tropicalis


Alignment Length:256 Identity:69/256 - (26%)
Similarity:113/256 - (44%) Gaps:52/256 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 DFLR----ICQESPKSVLEQEEL------ELDLAEISIEVERLDDLNEGPIQSSGFKVEDILNES 138
            |||:    |.||   .:.|.|:.      :.::.|:::         .||    |...|..||..
 Frog    58 DFLQGLAGIKQE---KIGEHEQYRFYGDRQAEIVEVTV---------GGP----GLIPELGLNRE 106

  Fly   139 KINEDEPNNEDDIDYSEMDYLIYESDTEVDAKQELKSDSENPKKRRNRRNPRDSNRTFFCEECGN 203
            .:...|.|..|              .||:.:.::.|..:...::.:::|...||:::...:    
 Frog   107 LLIRTEKNGFD--------------PTEIPSNKKTKRLNSEAQEAKSKRRRSDSSKSVGGD---- 153

  Fly   204 HIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRL 268
              .:..|...:.|.|.      ||.|...|.:...|:||:..||||:||:|..|:.||.......
 Frog   154 --GEAASLSPNQKPHI------CEHCSAAFRSSYHLRRHVLIHTGERPFQCSQCNMSFIQKYLLQ 210

  Fly   269 KHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRS 329
            :||:.|:.|:||.|.:||..|...|.::.|...|:|||.::||.|.:.|||...|..|.|:
 Frog   211 RHEKIHSGEKPFNCDQCNMKFIQKYHMERHKRTHSGEKPYKCDTCQQYFSRTDRLLKHKRT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 2/19 (11%)
COG5048 222..>276 CDD:227381 20/53 (38%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 10/21 (48%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 9/23 (39%)
C2H2 Zn finger 310..328 CDD:275368 8/17 (47%)
znf281XP_002935748.1 PS_II_S4 <53..>134 CDD:132113 21/105 (20%)
zf-C2H2 166..188 CDD:333835 8/27 (30%)
C2H2 Zn finger 168..188 CDD:275368 7/19 (37%)
zf-H2C2_2 180..205 CDD:372612 13/24 (54%)
C2H2 Zn finger 196..216 CDD:275368 6/19 (32%)
zf-H2C2_2 209..233 CDD:372612 10/23 (43%)
C2H2 Zn finger 224..244 CDD:275368 6/19 (32%)
zf-H2C2_2 236..261 CDD:372612 9/24 (38%)
C2H2 Zn finger 252..271 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.