Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012820272.1 | Gene: | LOC733507 / 733507 | -ID: | - | Length: | 478 | Species: | Xenopus tropicalis |
Alignment Length: | 198 | Identity: | 47/198 - (23%) |
---|---|---|---|
Similarity: | 79/198 - (39%) | Gaps: | 44/198 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 LEQEELELDLAEISIEVERLDDLNEGPIQSSGFKVEDILNESKINEDEPNNEDDIDYSEM--DYL 159
Fly 160 -IYESDTEVDAKQELKSDSENPKKRRNRRNPRD-SNRT---------FFCEECGN---HIKDRIS 210
Fly 211 FILHCKRHRGVKE-FGCEFCEDRFCTPAEL-------KRHIRKHTGEKPFKCRHCSRSF--SDYS 265
Fly 266 TRL 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
C2H2 Zn finger | 198..218 | CDD:275368 | 3/22 (14%) | ||
COG5048 | 222..>276 | CDD:227381 | 14/57 (25%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 3/26 (12%) | ||
zf-H2C2_2 | 238..262 | CDD:290200 | 7/32 (22%) | ||
C2H2 Zn finger | 254..274 | CDD:275368 | 7/17 (41%) | ||
zf-H2C2_2 | 269..291 | CDD:290200 | 47/198 (24%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | |||
zf-H2C2_2 | 295..319 | CDD:290200 | |||
C2H2 Zn finger | 310..328 | CDD:275368 | |||
LOC733507 | XP_012820272.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |