| Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001289476.1 | Gene: | Zfp131 / 72465 | MGIID: | 1919715 | Length: | 619 | Species: | Mus musculus |
| Alignment Length: | 313 | Identity: | 82/313 - (26%) |
|---|---|---|---|
| Similarity: | 128/313 - (40%) | Gaps: | 91/313 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 88 ICQESPKSVLEQEELELDLAEISIEV-----ERLDDLNEGP-----IQSSGFKVEDIL------- 135
Fly 136 -----NESK--INEDEPNNE------DDIDYSEMDY-----------------LIYESDTEVDAK 170
Fly 171 QELKSDSENPKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILH--C----------KRHRGVKE 223
Fly 224 FGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERT---------HTNERP 279
Fly 280 FVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAH 332 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | |
| C2H2 Zn finger | 198..218 | CDD:275368 | 6/31 (19%) | ||
| COG5048 | 222..>276 | CDD:227381 | 23/62 (37%) | ||
| C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 238..262 | CDD:290200 | 13/23 (57%) | ||
| C2H2 Zn finger | 254..274 | CDD:275368 | 8/28 (29%) | ||
| zf-H2C2_2 | 269..291 | CDD:290200 | 6/30 (20%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 295..319 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 310..328 | CDD:275368 | 7/17 (41%) | ||
| Zfp131 | NP_001289476.1 | BTB_POZ_ZBTB35_ZNF131 | 16..128 | CDD:349530 | |
| Nuclear localization signal 1. /evidence=ECO:0000250 | 137..148 | ||||
| COG5048 | <262..444 | CDD:227381 | 57/205 (28%) | ||
| C2H2 Zn finger | 263..283 | CDD:275368 | 5/40 (13%) | ||
| C2H2 Zn finger | 290..311 | CDD:275368 | 5/20 (25%) | ||
| Nuclear localization signal 2. /evidence=ECO:0000250 | 317..328 | 3/10 (30%) | |||
| C2H2 Zn finger | 330..350 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 342..367 | CDD:372612 | 14/24 (58%) | ||
| C2H2 Zn finger | 358..375 | CDD:275368 | 7/17 (41%) | ||
| C2H2 Zn finger | 394..414 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 422..439 | CDD:275370 | 6/16 (38%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 574..619 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000724 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||