DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG18764

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_652712.2 Gene:CG18764 / 59239 FlyBaseID:FBgn0042205 Length:409 Species:Drosophila melanogaster


Alignment Length:404 Identity:136/404 - (33%)
Similarity:191/404 - (47%) Gaps:73/404 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 CRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVLKNCSTLPNRLCASCQTCLQQAISFRERCL 70
            |||||.....:...|:|...|:..|:.|.|:||..|.|...||:.:||.|...|.|||.|||||:
  Fly     5 CRTCGSIIYNKMPKNLFHIENEKMLQDINLVTGTTLHNDPELPSSICACCTLDLNQAILFRERCI 69

  Fly    71 EVQRELLH----------SQDDEDFL--------------RICQESPKSVLEQE-----ELELDL 106
            ..|::|:|          ::|.|:..              ....|||:.||:.:     :|:.|.
  Fly    70 LTQKQLVHRRRSPEAKEPAEDVEEMASPPDCLNDPFGEVDEYIVESPEEVLDHDSDAHHDLDEDN 134

  Fly   107 AEISIE-VERLDDLNEGPIQSSGFKVEDILN------ESKINEDEPNNEDDIDYSEMDYLIYESD 164
            ...|:| |:.|.|:.|...:.|. .||.:::      ||..|:|  :|.|:.||.|.....|.::
  Fly   135 YIDSVEDVDALQDMAEVAEEDSQ-DVESLISSVQKELESICNDD--SNSDNNDYMEPQNGSYFNE 196

  Fly   165 T----EVD-------------AKQELKSDSENPKKRRN-------------RRNPRDSNRTFFCE 199
            |    ||.             |.:..|..:..||:::.             .|......|...||
  Fly   197 TINEYEVSSNPNTPLPESKSAAGRSTKPATTKPKRKKQYVTWKNMTEEQIIERKRLQRKRECVCE 261

  Fly   200 ECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIR-KHTGEKPFKCRHCSRSFSD 263
            :||....|:.:|.||..||.|.|.|.|:.|..||.|...:..|.| .|.||||:.||.|::||.:
  Fly   262 QCGRQFTDQSNFKLHMLRHTGNKNFACQQCGKRFYTDHLMTLHQRIIHQGEKPYDCRFCTKSFHN 326

  Fly   264 YSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYR 328
            .:|||.|||||||.:|:.|..|:..|.::...|.|.|:|||.:||.|.:|.:.|.|.|||..|.|
  Fly   327 SNTRLIHERTHTNAKPYSCHHCDKCFKSASGRKRHELIHTGVRAFACTICKQSFQRNTHLKAHLR 391

  Fly   329 SNAHRRNMQKADTI 342
            |..|   ..||.||
  Fly   392 SKFH---TAKAKTI 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 30/70 (43%)
C2H2 Zn finger 198..218 CDD:275368 8/19 (42%)
COG5048 222..>276 CDD:227381 27/54 (50%)
C2H2 Zn finger 226..246 CDD:275368 7/20 (35%)
zf-H2C2_2 238..262 CDD:290200 11/24 (46%)
C2H2 Zn finger 254..274 CDD:275368 11/19 (58%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 6/19 (32%)
zf-H2C2_2 295..319 CDD:290200 11/23 (48%)
C2H2 Zn finger 310..328 CDD:275368 8/17 (47%)
CG18764NP_652712.2 zf-AD 4..75 CDD:214871 30/69 (43%)
C2H2 Zn finger 260..280 CDD:275368 8/19 (42%)
zf-H2C2_2 272..297 CDD:290200 12/24 (50%)
C2H2 Zn finger 288..309 CDD:275368 7/20 (35%)
C2H2 Zn finger 317..337 CDD:275368 11/19 (58%)
C2H2 Zn finger 345..365 CDD:275368 6/19 (32%)
C2H2 Zn finger 373..391 CDD:275368 8/17 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I19075
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26093
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000724
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_120097
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.