DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and si:ch211-79k12.2

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001313520.1 Gene:si:ch211-79k12.2 / 568844 ZFINID:ZDB-GENE-131121-535 Length:555 Species:Danio rerio


Alignment Length:177 Identity:59/177 - (33%)
Similarity:85/177 - (48%) Gaps:12/177 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 ESDTEVDAKQELK---SDSENPKKRRNRRNPRDSNRT----FFCEECGNHIKDRISFILHCKRHR 219
            :...:.|..|:|.   .::..|:..:..::.|..:.|    |.|.|||.......:..:|...|.
Zfish   268 QGHAQQDGLQQLSCMHCNASFPRPSQLLQHQRTQHATKAGGFLCAECGRAFNSHSNLRIHLNVHT 332

  Fly   220 GVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKE 284
            |.:.:.|..|...|.....||.|.|.||||:|:.|.:|.|.|...:....|:|.||.|:|::|.:
Zfish   333 GARPYICTNCGKSFSQSGALKIHRRIHTGERPYTCSYCGRGFPHLAGVRAHQRIHTGEKPYICGQ 397

  Fly   285 CNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFS-----RYTHLTTH 326
            |...||.|..||.|..:||||:.|.|.||.|.||     |:.|.|.|
Zfish   398 CGKCFTQSGALKIHTRIHTGERPFVCGLCGKSFSNRSGIRFHHRTVH 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 5/19 (26%)
COG5048 222..>276 CDD:227381 19/53 (36%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 9/21 (43%)
C2H2 Zn finger 282..302 CDD:275368 8/19 (42%)
zf-H2C2_2 295..319 CDD:290200 14/28 (50%)
C2H2 Zn finger 310..328 CDD:275368 10/22 (45%)
si:ch211-79k12.2NP_001313520.1 C2H2 Zn finger 281..302 CDD:275368 2/20 (10%)
C2H2 Zn finger 311..331 CDD:275368 5/19 (26%)
zf-H2C2_2 323..348 CDD:290200 6/24 (25%)
C2H2 Zn finger 339..359 CDD:275368 7/19 (37%)
zf-H2C2_2 351..374 CDD:290200 12/22 (55%)
C2H2 Zn finger 367..387 CDD:275368 6/19 (32%)
zf-H2C2_2 380..404 CDD:290200 9/23 (39%)
C2H2 Zn finger 395..415 CDD:275368 8/19 (42%)
zf-H2C2_2 407..432 CDD:290200 13/24 (54%)
C2H2 Zn finger 423..442 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.