DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and MYNN

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_001172047.1 Gene:MYNN / 55892 HGNCID:14955 Length:610 Species:Homo sapiens


Alignment Length:386 Identity:98/386 - (25%)
Similarity:153/386 - (39%) Gaps:85/386 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 IKLLTGAVLKN-----CSTLPNRLCASCQTCLQQAISF--RERCLEVQRELLHSQDDEDFL---- 86
            ||:...|.:.|     .|::...:..:.||||.....:  ||:. ||..:|:.:...:..|    
Human   113 IKMEDFAFIANPSSTEISSITGNIELNQQTCLLTLRDYNNREKS-EVSTDLIQANPKQGALAKKS 176

  Fly    87 ------RICQESPKS-----------VLEQEELELDL------AEISIEVERLDDLNEGPIQS-- 126
                  :....|||:           :||...:||.|      ..:..:|.:::|.:|..:.|  
Human   177 SQTKKKKKAFNSPKTGQNKTVQYPSDILENASVELFLDANKLPTPVVEQVAQINDNSELELTSVV 241

  Fly   127 -SGFKVEDILN----ESKINEDEPN------NEDDIDYSEMDYLIYESDTEVDAKQEL------- 173
             :.|..:||::    :.|..:.:||      :..:|...:..|....|..|:|.:...       
Human   242 ENTFPAQDIVHTVTVKRKRGKSQPNCALKEHSMSNIASVKSPYEAENSGEELDQRYSKAKPMCNT 306

  Fly   174 --KSDSENPKKRRNRR---------------------------NPRDSNRTFFCEECGNHIKDRI 209
              |..||....||:.|                           ......:.:.||.|......:.
Human   307 CGKVFSEASSLRRHMRIHKGVKPYVCHLCGKAFTQCNQLKTHVRTHTGEKPYKCELCDKGFAQKC 371

  Fly   210 SFILHCKRHRG-VKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERT 273
            ..:.|.:.|.| .|.:.|:.|..:|.|.:.||.|.|||:||||:.|..|.:.|:..||...|.|.
Human   372 QLVFHSRMHHGEEKPYKCDVCNLQFATSSNLKIHARKHSGEKPYVCDRCGQRFAQASTLTYHVRR 436

  Fly   274 HTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRR 334
            ||.|:|:||..|..||..|..|..|...|||||.:.|.:|.|.|.....|..|:||:...|
Human   437 HTGEKPYVCDTCGKAFAVSSSLITHSRKHTGEKPYICGICGKSFISSGELNKHFRSHTGER 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 13/50 (26%)
C2H2 Zn finger 198..218 CDD:275368 4/19 (21%)
COG5048 222..>276 CDD:227381 23/53 (43%)
C2H2 Zn finger 226..246 CDD:275368 8/19 (42%)
zf-H2C2_2 238..262 CDD:290200 12/23 (52%)
C2H2 Zn finger 254..274 CDD:275368 7/19 (37%)
zf-H2C2_2 269..291 CDD:290200 11/21 (52%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-H2C2_2 295..319 CDD:290200 11/23 (48%)
C2H2 Zn finger 310..328 CDD:275368 6/17 (35%)
MYNNNP_001172047.1 BTB 14..115 CDD:306997 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 169..197 4/27 (15%)
Nuclear localization signal. /evidence=ECO:0000255 174..190 1/15 (7%)
Nuclear localization signal. /evidence=ECO:0000255 257..262 1/4 (25%)
C2H2 Zn finger 304..324 CDD:275368 6/19 (32%)
zf-C2H2 304..324 CDD:306579 6/19 (32%)
zf-H2C2_2 316..341 CDD:316026 3/24 (13%)
C2H2 Zn finger 332..352 CDD:275368 0/19 (0%)
zf-H2C2_2 345..369 CDD:316026 3/23 (13%)
SFP1 <354..438 CDD:227516 28/83 (34%)
C2H2 Zn finger 360..380 CDD:275368 4/19 (21%)
C2H2 Zn finger 389..409 CDD:275368 8/19 (42%)
C2H2 Zn finger 417..437 CDD:275368 7/19 (37%)
zf-H2C2_2 430..453 CDD:316026 10/22 (45%)
SFP1 <439..522 CDD:227516 24/59 (41%)
C2H2 Zn finger 445..465 CDD:275368 7/19 (37%)
C2H2 Zn finger 473..493 CDD:275368 7/19 (37%)
C2H2 Zn finger 501..522 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 521..556
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.