DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and znf280d

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:XP_005166581.1 Gene:znf280d / 556610 ZFINID:ZDB-GENE-030131-2260 Length:879 Species:Danio rerio


Alignment Length:186 Identity:49/186 - (26%)
Similarity:81/186 - (43%) Gaps:34/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 KSDSE---NPKKRRNRRNPRDSNRTFFCEECGNHIKDRISFILHCKRHRGVKEFG---------C 226
            |||.:   .||.:        ||.||.|..|...:|:.|.|:.|.|.|..:::..         |
Zfish   333 KSDGDPSLMPKIK--------SNTTFKCNSCLKMLKNNIRFMNHMKHHLELEKQNSESWESHTTC 389

  Fly   227 EFCEDRFCTPAELKRHIRKHTGEKPFK----CRHCSRSFSDYSTRLKHERTH--TNERPFVCKEC 285
            :.|..::.||.:|:.||  .:...||:    |:.|..:|......|:|.|.:  ..|.|:.|:.|
Zfish   390 QHCYRQYSTPFQLQCHI--ESAHSPFESSTNCKICELAFETEQVLLEHMRDNHKPGEMPYGCQVC 452

  Fly   286 NNAFTTSYI--LKNHM-LVHTGEKAFRCDLCDKLFSRYTHLTTHYRSNAHRRNMQK 338
            |  :.:|:.  :.||. .||...|...|..|.|:. |..|:...:.....::.:|:
Zfish   453 N--YRSSFFCDVDNHFRTVHENTKDLLCPFCLKVL-RSGHMYMQHYMRHQKKGIQR 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871
C2H2 Zn finger 198..218 CDD:275368 7/19 (37%)
COG5048 222..>276 CDD:227381 15/68 (22%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 7/27 (26%)
C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
zf-H2C2_2 269..291 CDD:290200 7/23 (30%)
C2H2 Zn finger 282..302 CDD:275368 6/22 (27%)
zf-H2C2_2 295..319 CDD:290200 8/24 (33%)
C2H2 Zn finger 310..328 CDD:275368 5/17 (29%)
znf280dXP_005166581.1 C2H2 Zn finger 352..386 CDD:275371 8/33 (24%)
C2H2 Zn finger 389..410 CDD:275368 7/22 (32%)
C2H2 Zn finger 419..440 CDD:275368 6/20 (30%)
C2H2 Zn finger 449..468 CDD:275368 6/20 (30%)
DUF2890 740..>821 CDD:287991
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.