| Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001271456.1 | Gene: | ZSCAN32 / 54925 | HGNCID: | 20812 | Length: | 697 | Species: | Homo sapiens |
| Alignment Length: | 440 | Identity: | 92/440 - (20%) |
|---|---|---|---|
| Similarity: | 158/440 - (35%) | Gaps: | 140/440 - (31%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 15 AERSLNIFEKRNQTTLEHIKLLTG------------AVLKNCSTLPNRLCASCQTCLQQAISFRE 67
Fly 68 RCLEVQRELLHSQDDEDFLRI---CQESPKS---------------------------------- 95
Fly 96 ------VLEQEELELDLAEISIEVERLDDLNEGPIQSSGFKVEDILN------------------ 136
Fly 137 --ESKINEDEPNN--EDDIDYSEMDYLIYESDTEVDAKQELKS--DSENPKKRRNRRNPRD---- 191
Fly 192 -------SNRTFF----------------------------------CEECGNHIKDRISFILHC 215
Fly 216 KRHRGVKEFGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPF 280
Fly 281 VCKECNNAFTTSYILKNHMLVHTGEKAFRCDLCDKLFSRYTHLTTHYRSN 330 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | 15/73 (21%) |
| C2H2 Zn finger | 198..218 | CDD:275368 | 5/19 (26%) | ||
| COG5048 | 222..>276 | CDD:227381 | 21/53 (40%) | ||
| C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 238..262 | CDD:290200 | 11/23 (48%) | ||
| C2H2 Zn finger | 254..274 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 269..291 | CDD:290200 | 10/21 (48%) | ||
| C2H2 Zn finger | 282..302 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 295..319 | CDD:290200 | 9/23 (39%) | ||
| C2H2 Zn finger | 310..328 | CDD:275368 | 6/17 (35%) | ||
| ZSCAN32 | NP_001271456.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..33 | ||
| SCAN | 33..142 | CDD:128708 | |||
| SCAN | 33..121 | CDD:280241 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 144..177 | ||||
| KRAB_A-box | 218..250 | CDD:295379 | 5/19 (26%) | ||
| Myb_DNA-bind_4 | 253..334 | CDD:290549 | 14/93 (15%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 347..395 | 7/47 (15%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 451..482 | 6/30 (20%) | |||
| COG5048 | <455..668 | CDD:227381 | 53/201 (26%) | ||
| zf-C2H2 | 522..543 | CDD:278523 | 5/20 (25%) | ||
| C2H2 Zn finger | 523..543 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 535..559 | CDD:290200 | 6/23 (26%) | ||
| C2H2 Zn finger | 551..571 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 563..588 | CDD:290200 | 12/24 (50%) | ||
| C2H2 Zn finger | 579..599 | CDD:275368 | 7/19 (37%) | ||
| zf-H2C2_2 | 591..616 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 607..627 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 623..644 | CDD:290200 | 9/20 (45%) | ||
| C2H2 Zn finger | 635..655 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 647..671 | CDD:290200 | 2/9 (22%) | ||
| zf-C2H2 | 661..683 | CDD:278523 | |||
| C2H2 Zn finger | 663..683 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||