Sequence 1: | NP_649824.1 | Gene: | ranshi / 41041 | FlyBaseID: | FBgn0037620 | Length: | 346 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_732827.1 | Gene: | CG31365 / 42736 | FlyBaseID: | FBgn0051365 | Length: | 639 | Species: | Drosophila melanogaster |
Alignment Length: | 582 | Identity: | 109/582 - (18%) |
---|---|---|---|
Similarity: | 175/582 - (30%) | Gaps: | 263/582 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 VCRTCGKRTNAERSLNIFEKRNQTTLEHIKLLTGAVL--KNCSTLPNRLCASCQTCLQQAISFRE 67
Fly 68 RC-------------------------------------------LEVQRELLHSQDD---EDF- 85
Fly 86 -------------------LRICQESPKSVLEQ--EELELDLAEISIEVERLDDL-NE------- 121
Fly 122 ----------------------------------------GPIQS--------------SGFKVE 132
Fly 133 DILNESK-------INEDEPNNED-DIDYSEMD-----------------------------YLI 160
Fly 161 ---------------YESDT---------------------------------EVDAKQELKS-- 175
Fly 176 -------------DSENPKKRRNRR-----------NPR-----DSNRTFFCEECGNHIKDRISF 211
Fly 212 ILHCKRH-RGVKE-----FGCEFCEDRFCTPAELKRHIRKHTGEKPFKCRHCSRSFSDYSTRLKH 270
Fly 271 ERTHTNERPFVCKECNNAFTTSYILKNHM-LVHTG-EKAFRCDLCDKLFSRYT----HLTTH 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ranshi | NP_649824.1 | zf-AD | 5..77 | CDD:214871 | 23/116 (20%) |
C2H2 Zn finger | 198..218 | CDD:275368 | 3/19 (16%) | ||
COG5048 | 222..>276 | CDD:227381 | 22/58 (38%) | ||
C2H2 Zn finger | 226..246 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 238..262 | CDD:290200 | 14/23 (61%) | ||
C2H2 Zn finger | 254..274 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 269..291 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 282..302 | CDD:275368 | 5/20 (25%) | ||
zf-H2C2_2 | 295..319 | CDD:290200 | 9/25 (36%) | ||
C2H2 Zn finger | 310..328 | CDD:275368 | 8/21 (38%) | ||
CG31365 | NP_732827.1 | zf-AD | 13..86 | CDD:214871 | 20/74 (27%) |
vATP-synt_E | 109..>244 | CDD:304907 | 19/135 (14%) | ||
RRF | <161..222 | CDD:294170 | 12/61 (20%) | ||
zf-C2H2_8 | 454..530 | CDD:292531 | 23/75 (31%) | ||
C2H2 Zn finger | 485..505 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 497..522 | CDD:290200 | 15/24 (63%) | ||
C2H2 Zn finger | 513..533 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 526..550 | CDD:290200 | 7/23 (30%) | ||
C2H2 Zn finger | 541..562 | CDD:275368 | 5/20 (25%) | ||
C2H2 Zn finger | 571..591 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 598..617 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 62 | 1.000 | Inparanoid score | I2531 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.050 |