DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ranshi and CG4936

DIOPT Version :9

Sequence 1:NP_649824.1 Gene:ranshi / 41041 FlyBaseID:FBgn0037620 Length:346 Species:Drosophila melanogaster
Sequence 2:NP_650862.1 Gene:CG4936 / 42393 FlyBaseID:FBgn0038768 Length:521 Species:Drosophila melanogaster


Alignment Length:484 Identity:118/484 - (24%)
Similarity:180/484 - (37%) Gaps:153/484 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VCRTCGKRTNAERSLNIFEKRNQTTLEH-IKLLTGAVLKNCSTLPNRLCASCQTCLQQAISFRER 68
            |||.|.::.. |...:||...::..|.| |:...|..:|.....|:::|..|...|:.|..|||.
  Fly    22 VCRVCLQQPK-EPMASIFNDDSEKDLTHMIRECGGVPIKQFDHYPDKICEKCFKVLKMAFKFRET 85

  Fly    69 C-------------LEVQRELLHSQDDEDFLRI--------CQESPKSVLEQEELEL-------- 104
            |             :||::.....:..|...::        .::.|:...|.|:::|        
  Fly    86 CQRSYGHLRQFVGPVEVEQRPPEKKGSETATKLEPDVDPDEAEQEPEHDEEDEDVDLDESHYAEA 150

  Fly   105 -DLAE---------------ISIEVERLDDLNEGPIQSSGFKVEDILN-----ESKINEDEPNNE 148
             |.||               :.:|.:|:..:....::..|. :|::.:     |..:..|:..:.
  Fly   151 DDAAETQGGVFHDEIEDGILVELEKDRIVHVKNEQVEEDGI-IEEVYDVYETYEGDLIPDQGYDH 214

  Fly   149 DDIDY------SEMDYL-------IYESDTEVDAKQELKSDSE---------------NPKKRR- 184
            :..|.      :|::||       :.||..|.||:.:|.|..|               |..||| 
  Fly   215 EMADQALSELSAEIEYLDQVEHDQLTESAHEDDAEVDLNSTEEEFVPSKSVRASIHARNATKRRV 279

  Fly   185 ----------------------NRRNPRDSNR--------------------------------- 194
                                  :|.||....|                                 
  Fly   280 NPRRSATSTASVAVESSTSKTTDRGNPLKVRRGNSDSAGSKMSIKSEKDISIGEVLARKHSGIKT 344

  Fly   195 --------------TFFCEECGNHIKDRISFILHCKRHRGVKEFGCEFCEDRFCTPAELKRHIRK 245
                          .:.|:.|||....:.....|.|.|.|||...||.|...|....:|.||:..
  Fly   345 KGGHKILLGDKKEFKYICDVCGNMYPSQSRLTEHIKVHSGVKPHECEICGHCFAQAQQLARHMNT 409

  Fly   246 HTGEKPFKCRHCSRSFSDYSTRLKHERTHTNERPFVCKECNNAFTTSYILKNHMLVHTGEKAFRC 310
            |||.:|:||.:|..:|:|.|||.||.|.||||||:.|..|:..||.:..||.|.::|||||...|
  Fly   410 HTGNRPYKCSYCPAAFADLSTRNKHHRIHTNERPYECDVCHKTFTYTNTLKFHKMIHTGEKPHVC 474

  Fly   311 DLCDKLFSRYTHLTTHYRSNAHRRNMQKA 339
            |:|.|.|.:...|..|  ...|.|..|.|
  Fly   475 DVCGKGFPQAYKLRNH--RVIHERRGQSA 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ranshiNP_649824.1 zf-AD 5..77 CDD:214871 23/85 (27%)
C2H2 Zn finger 198..218 CDD:275368 6/19 (32%)
COG5048 222..>276 CDD:227381 24/53 (45%)
C2H2 Zn finger 226..246 CDD:275368 7/19 (37%)
zf-H2C2_2 238..262 CDD:290200 10/23 (43%)
C2H2 Zn finger 254..274 CDD:275368 10/19 (53%)
zf-H2C2_2 269..291 CDD:290200 12/21 (57%)
C2H2 Zn finger 282..302 CDD:275368 7/19 (37%)
zf-H2C2_2 295..319 CDD:290200 13/23 (57%)
C2H2 Zn finger 310..328 CDD:275368 7/17 (41%)
CG4936NP_650862.1 zf-AD 22..95 CDD:214871 21/73 (29%)
C2H2 Zn finger 362..382 CDD:275368 6/19 (32%)
zf-H2C2_2 375..399 CDD:290200 10/23 (43%)
COG5048 386..>447 CDD:227381 29/60 (48%)
C2H2 Zn finger 390..410 CDD:275368 7/19 (37%)
zf-H2C2_2 403..426 CDD:290200 10/22 (45%)
C2H2 Zn finger 418..438 CDD:275368 10/19 (53%)
zf-H2C2_2 432..455 CDD:290200 12/22 (55%)
C2H2 Zn finger 446..466 CDD:275368 7/19 (37%)
zf-H2C2_2 459..481 CDD:290200 12/21 (57%)
C2H2 Zn finger 474..494 CDD:275368 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I3338
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.